KEGG   Hydrogenobacter thermophilus: Hydth_1568Help
Entry
Hydth_1568        CDS       T02106                                 

Definition
acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Hydth_1568
Enzymes [BR:hte01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Hydth_1568
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Hydth_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1444744..1445298)
Genome map
AA seq 184 aa AA seqDB search
MSLLVLYDEEGKVLKVEMDHDSIVKTLEDLCIIFQRWQVKNLPEDASEEDVLKAYEKEIE
SIKSFYKFVSLDVASITPDHPKKSELRNMFLREHTHSDFEVRFFVDGMGTFYLHLRDKVY
AVVCEKGDFISVPANTPHWFDMGKNPSFKAIRFFSIPEGWVANFTGSDISEKIPDHDSIV
SSWL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagcttacttgtcctctatgatgaggaaggaaaggttttaaaggtagaaatggatcac
gatagcatagttaaaactcttgaagacctgtgcataatctttcaaaggtggcaggtaaaa
aatctaccagaagatgcctctgaggaagatgtcctaaaagcttacgagaaagagatagaa
agcattaaaagtttttataaatttgtttctttggatgtggcaagtatcacacccgaccat
cccaaaaagagcgagcttagaaacatgtttttgagggagcatacccactctgactttgaa
gtgcgtttctttgtggatggaatgggtaccttttaccttcatttgagggataaagtttat
gccgttgtttgtgaaaagggagattttataagcgttcctgccaatacaccccactggttt
gacatgggcaaaaatccctcttttaaagctatacgcttcttttctattccagagggatgg
gtagctaactttacaggtagtgatatatccgagaaaattcccgaccacgacagcatagta
agttcatggctatga

DBGET integrated database retrieval system