KEGG   Hydrogenobacter thermophilus: Hydth_1825Help
Entry
Hydth_1825        CDS       T02106                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hte  Hydrogenobacter thermophilus
Pathway
hte00860  Porphyrin and chlorophyll metabolism
hte01100  Metabolic pathways
hte01110  Biosynthesis of secondary metabolites
hte01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hydth_1825
Enzymes [BR:hte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Hydth_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Arylesterase ELL UPF0052
Motif
Other DBs
NCBI-ProteinID: ADO46206
UniProt: D3DKD4
Position
1676384..1677094
Genome map
AA seq 236 aa AA seqDB search
MIKVVLTRSEEDIQKDRELFEREGFVVIPLPLIKTEPVEFELLEDDFDFVVFPSAKAVNY
FLSRRRLKGNEKVIAVGEATKKAVERYNYSVYQVPENYYAEEIKLLLKGQKGKVLIPRSQ
EGREELIKELENLGFYVKALNVYTTKGVLYQKEEFLKKISEGDVVVFASPSAVRSFFANL
PKPEGAAILKEKKVVCIGKTTNQELFSLCGHSGLLPEKPSFESIVKLLKSLAQSLQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagttgtgctaaccagaagtgaggaggatatacaaaaagacagagagcttttt
gagagggaagggtttgtggtaatcccattacctcttataaaaactgagcctgttgagttc
gagcttctggaggatgactttgactttgttgtttttcccagtgctaaagcggtaaattac
tttctaagtagaagaaggttaaaaggtaacgaaaaggtcatagcggtgggtgaggctact
aaaaaagctgttgaaaggtataactacagtgtttatcaagttccagaaaattactacgct
gaagagataaaacttctgctgaaaggacagaaaggtaaggtgcttattccacgctcacag
gaaggtagagaggagcttataaaagagcttgagaatttaggcttctatgtaaaagcttta
aatgtttataccacaaaaggtgtgctttaccaaaaagaggagtttttgaagaagatatct
gagggtgatgttgttgtgtttgcaagcccttcagctgtcaggagcttttttgcaaatttg
ccaaagcctgagggtgcagctattttaaaagagaaaaaggtggtttgtattggcaaaact
accaatcaagagcttttttccctttgcggacattccgggcttttgcccgaaaaaccgagc
tttgaaagcattgtaaaactcttaaagtctctggcacagagtttgcaataa

DBGET integrated database retrieval system