KEGG   Hydrogenobacter thermophilus: Hydth_1875Help
Entry
Hydth_1875        CDS       T02106                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hte  Hydrogenobacter thermophilus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hydth_1875
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hydth_1875
   00640 Propanoate metabolism
    Hydth_1875
   00660 C5-Branched dibasic acid metabolism
    Hydth_1875
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hydth_1875
Enzymes [BR:hte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hydth_1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1717319..1718470)
Genome map
AA seq 383 aa AA seqDB search
MKLHEHQAKEILKRYNLPVPEGKVAFSLQEALQVAEELSGYPLVVKAQVHCGGRGKAGGV
KLVKNQEELREAVESMLGKVLKTFQCPEGKPVSRVWIEKATNIEKEFYLSITLDRSVSKP
VFMASAEGGMEIEEVAKEKPEAIHTLHIDPALGLMPFQARKIAFKLGLPVNEFVRISLAL
YKMYTDMDASLVEINPLVLTKEGNLILLDAKVEIDDNAMLRHKDVEELEDLTQLDPLEIE
AKRYSLNYIKLDGNIGCMVNGAGLAMTTMDIIKLAGGDPANFLDVGGGANVEQIANAFRI
LMADKNVKAVFINIFGGILRCDRLAQGLIEAAKMVEIKVPVVVRMEGTNVEEGRRLLSES
GLNFVNAVDMWDGAKKATELALR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaacatcaggctaaggaaattttaaaaagatataacttacctgttcca
gaaggtaaggtagcttttagccttcaggaggctctgcaggttgctgaagagcttagcgga
tatcctttggtggtcaaagctcaggtacactgtggaggaagaggtaaagcaggcggtgta
aagctggtaaagaatcaggaggagctaagagaagcagttgaaagcatgctggggaaagtt
ttaaagaccttccagtgtcccgaaggtaagcctgtgagtagagtatggatagaaaaggct
accaacatagaaaaagagttttatctttccataactcttgacaggtctgtctcaaaacct
gtttttatggcaagcgcggaaggtggcatggagatagaagaagtggcaaaggaaaagcca
gaagctatacacacgctgcacatagacccagccctcggtcttatgccctttcaagcaagg
aagatagcctttaaacttggacttcccgtaaatgagtttgtaaggatatcccttgctctc
tacaagatgtatacggacatggatgccagcttggtggagataaacccactggtgcttact
aaagaaggaaacctaatcctcttggatgccaaggtggagatagacgataatgcaatgcta
aggcacaaggacgtggaggagcttgaggaccttacacagcttgacccccttgaaatagag
gcaaagcgttatagtctcaattacataaagctggatggtaacataggttgtatggtaaac
ggtgcaggtcttgccatgacaactatggacataataaagctggcgggcggagaccctgct
aacttccttgatgtgggtggaggtgctaatgtggaacagatagccaacgctttcaggatt
ctgatggctgacaaaaatgtaaaagcagtctttataaacatctttggggggatactcaga
tgcgataggttagctcaaggtcttatagaggcggcaaagatggtggagataaaggtgccg
gtggtggtcagaatggaggggactaatgtggaggagggaagaagattactgtcagagtcc
ggactaaactttgtcaatgctgtagatatgtgggacggtgccaaaaaggcaactgagttg
gcattaaggtaa

DBGET integrated database retrieval system