KEGG   Hydrogenobacter thermophilus: HTH_0038Help
Entry
HTH_0038          CDS       T01167                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HTH_0038 (glgB)
Enzymes [BR:hth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HTH_0038 (glgB)
Exosome [BR:hth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HTH_0038 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(42810..44717)
Genome map
AA seq 635 aa AA seqDB search
MPVYFIFFYMNLSMITDYDIYLFKEGSHCRLYEKLGAHPLEGGVYFAVWAPNARYVSVVG
SFNSWDRGANPLKLREDGSGIWEGFVEKARVGDLYKYFIVSKSGYEAEKADPFGFFFEVS
PKTASIVWDLSYQWKDQEWMKERHKKNALDSPWLIYEVHLGSWKKKGWESLSYRELAEEL
VEYIKEMGFTHVEFLPVMEHPFYGSWGYQITGYFAPTSRYGTPQDFMYLIDRLHQEGIGV
ILDWVPSHFPTDGHALAYFDGTHLYEYEDFRKRYHPDWNSYIFDYSKPEVRSFLLSSAHF
WLGIYHADGIRVDAVASMLYLDYSRKPGEWVPNIYGGKENLEAIEFIRKLNECLYRDFPG
IQTIAEESTAWPMVTKPTYLGGLGFGMKWNMGWMHDTLFYFSKDPIHRKYHQDKLAFSLW
YAFSENFVLVLSHDEVVYGKGSLINKMPKDWWQKFANLRLLLTYMYAHPGKKLLFMGGEF
GQWDEWNHDRGLDWFLLEHSTHRGVQKLVRDLNRVVKENPALYELDFSHEGFEWIDFSDT
DQSVISFLRKDRSGKNIFLSVFNFTPVPRYNYRIGVPYRGFWKKIINSDALEYGGSGHGD
TEAVHTEDVPFHGRPYSICLTLPSLAGLYFTIALS
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtatattttatattcttttacatgaatttatctatgatcacagattatgacatt
tatctttttaaagaaggtagccactgcaggctttacgaaaagcttggtgctcacccatta
gaaggaggtgtttactttgcggtctgggcacctaacgccaggtatgtttccgttgtagga
agcttcaacagctgggacagaggggcaaaccctctaaagctcagggaagatggctctggc
atatgggaaggatttgtagaaaaggcaagagtgggggacctctacaagtactttatagtg
tcaaagagcggttatgaagcggaaaaggcggaccctttcggttttttctttgaggtttct
cccaaaaccgccagcatagtgtgggaccttagctaccagtggaaagaccaagagtggatg
aaagaaaggcacaaaaagaacgctctggattcaccttggttgatttacgaggtgcacctt
ggctcgtggaaaaagaaagggtgggagtctttgagctacagagagctggccgaggagctg
gtggaatacatcaaggagatgggctttacccatgtggagtttctgcctgtcatggagcat
cccttttatggctcgtgggggtatcagattactggctactttgctcccacctccagatac
ggaacaccgcaggactttatgtatctcatagatagattacatcaagaaggtattggtgta
attctggactgggtgccttctcactttcccacggatggacatgcgcttgcatactttgat
ggcacgcacctttacgagtatgaggacttcaggaagagataccatcctgactggaacagc
tacatatttgactactccaagcccgaggttaggtccttccttctctcttcagcgcatttt
tggctcggcatttatcacgcggacggcataagggtggatgcggtagcctccatgctctac
ctggactactccagaaaacccggcgagtgggtgcccaacatctatggcggtaaggaaaac
cttgaggcaattgagtttataagaaaactaaacgagtgcctctacagggactttccgggc
attcagaccatagcggaggagtccacagcctggcccatggtgacaaaacccacatacctg
ggcggtcttggctttggtatgaagtggaatatgggttggatgcacgacaccctcttttat
ttttcaaaggaccccatacacagaaagtaccatcaggacaagctcgccttcagtctgtgg
tatgccttctcagaaaactttgtgctggttctttctcatgatgaggtggtgtatggtaag
gggtcgctaataaacaaaatgccaaaggactggtggcagaagtttgccaatttaaggctt
ttactaacttacatgtacgcgcatccgggtaaaaaacttctctttatgggaggagagttt
ggtcagtgggatgagtggaatcacgataggggtctggattggtttttgctggagcactcc
acccacagaggagtgcagaagttggtaagggacctaaacagagtagtgaaagaaaatcca
gctctttatgagcttgatttcagtcatgaaggctttgagtggattgatttttctgacacg
gatcaaagtgtgataagctttctgaggaaggacaggtcaggtaaaaacatctttctatca
gtctttaacttcactcctgtgccaagatacaactacagaataggtgttccctacaggggc
ttttggaagaagatcataaacagcgatgcgctggagtacggtggctctgggcatggagat
acggaagcggttcacacggaagatgtacctttccatggaagaccttactctatttgcttg
acgcttccatctcttgcagggctttactttacaatagctctttcataa

DBGET integrated database retrieval system