KEGG   Hydrogenobacter thermophilus: HTH_0077Help
Entry
HTH_0077          CDS       T01167                                 

Gene name
acs
Definition
(GenBank) acyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hth  Hydrogenobacter thermophilus
Pathway
hth00010  Glycolysis / Gluconeogenesis
hth00620  Pyruvate metabolism
hth00640  Propanoate metabolism
hth00680  Methane metabolism
hth00720  Carbon fixation pathways in prokaryotes
hth01100  Metabolic pathways
hth01110  Biosynthesis of secondary metabolites
hth01120  Microbial metabolism in diverse environments
hth01130  Biosynthesis of antibiotics
hth01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HTH_0077 (acs)
   00620 Pyruvate metabolism
    HTH_0077 (acs)
   00640 Propanoate metabolism
    HTH_0077 (acs)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HTH_0077 (acs)
   00680 Methane metabolism
    HTH_0077 (acs)
Enzymes [BR:hth01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HTH_0077 (acs)
Lipid biosynthesis proteins [BR:hth01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HTH_0077 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAI68544
UniProt: D3DFE2
Position
79637..81532
Genome map
AA seq 631 aa AA seqDB search
MVEDRSETLLKVEEKYMPPPSIVESAWVRDYETLYQESIKDREAFWAKVAEDLHWFKKWD
KVLEWNYPYAKWFVGGKTNITYNCLDRHVKNGKRNKVAYIALDEDSREKKITYGELLELV
NRIANGLKSLGVKKGDRVSIYMPNTVEAVACMLACARIGAIHSLVFAGFSEGALRLRIED
AKAKVVITASYTKRRGKKIDLLATAQRAIDGLDFVEKVIVWDRDGDVLNGEDKFFVSLDE
LISTSSPKCEPEVMDAEDPLYILYTSGTTGKPKGVLHTTGGYMVGTYYTTKVVFDLKEDD
IYWCTADIGWVTGHSYIVYGPLAVGATSLIVEGAPDYPDPGRWWSYVEKYRVNIFYTAPT
AVRMFMKYGEQWPAKYDLSSLRILGSVGEPINPEAWHWYFKNIGREKCVIVDTWWQTETG
MHMITTIPSYPAKPGKAGKPFFGIEALVVDRHGNVLPPNTIGNLVIKTPWPSMLRTCWGE
PERYEKYWNTIPGYYLTGDLASYDEEGYIMILGRADDVLNVAGHRIGTMEVESAIVDYPA
VAEAAVIGKPHEVKGESIKAFVILKKGYEPSEKLVEEIKYHVKQVLGPIAVPDEIEFVEK
LPKTRSGKIMRRVLKAQELGLPVGDISTLED
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggtggaagataggtctgagacacttttaaaagttgaggaaaagtacatgcctcctccg
tctatagtagagtccgcatgggtgagggattatgaaaccctataccaggaatccattaag
gacagagaagctttctgggcaaaggttgcggaggacctgcactggtttaaaaagtgggat
aaggttttggaatggaactatccatatgccaagtggttcgtaggaggaaaaactaacata
acttataactgccttgacaggcatgtaaaaaatggcaagaggaataaggtagcctacata
gcccttgatgaggacagcagggaaaagaaaattacttatggagagcttttggaacttgta
aatcgtatagccaacggacttaagtctcttggagttaaaaagggtgatagggtttccata
tacatgcctaatacggtagaagcagttgcatgtatgttggcatgtgcaaggataggagct
atacacagtctggtttttgcaggctttagtgaaggtgctttgaggctcaggatagaggat
gcaaaagcaaaggtggttataacagcaagttatactaagagaaggggtaaaaagatagac
ctgcttgcaactgcacagagggcaatagatggtcttgactttgtagaaaaagttatagtt
tgggacagggatggcgatgtgctaaatggggaggacaagttctttgtgagtcttgatgag
cttataagcaccagctcacccaagtgcgagccagaagttatggacgctgaggaccctctt
tacatactttacacatctggaactacaggcaagccaaagggtgtgctacacaccacaggt
ggctacatggtgggaacatactacaccacaaaggtggtttttgacctcaaagaggatgat
atatactggtgtaccgcagatataggctgggtgacaggacacagctacatagtgtatggt
ccacttgctgtgggtgccacatctctaatagtggaaggagcacccgattaccctgacccg
ggaaggtggtggagctatgtagaaaagtacagagttaacatcttttacaccgcgcctacg
gcggtaagaatgtttatgaagtacggtgagcagtggcctgccaagtatgacctctcttcg
ctgaggatattgggctcggttggtgaacccataaacccggaagcgtggcactggtacttt
aagaacataggaagagaaaagtgcgtcatagtggacacctggtggcagacagaaacaggc
atgcacatgataaccaccataccttcttaccctgcaaaaccgggtaaggcaggcaaaccc
ttctttggcatagaggctcttgtagtggacagacacgggaatgtcctcccccccaacacc
ataggcaacctcgttataaaaacaccctggccttctatgctcagaacctgctggggagag
ccagagaggtacgaaaagtactggaacaccatacccggatactatctgacaggagaccta
gcttcttatgacgaggagggatacataatgattctgggaagggctgacgatgtgctaaat
gttgcaggacacaggataggaactatggaagtggaaagcgccatagtggactatcctgct
gtggctgaagctgcagttatcggaaaaccccacgaggttaagggagaatctataaaggct
tttgtgatactcaagaagggttatgagccatctgaaaagctcgttgaggaaataaagtac
catgtgaagcaggtgctgggacctatagcggtgcctgacgagatagagtttgttgaaaag
cttcccaagaccagaagcggaaagataatgagaagagttctaaaggctcaggagcttggg
cttccggttggagacatatccacccttgaggactga

DBGET integrated database retrieval system