KEGG   Hydrogenobacter thermophilus: HTH_0077Help
Entry
HTH_0077          CDS       T01167                                 

Gene name
acs
Definition
acyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HTH_0077 (acs)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HTH_0077 (acs)
   00620 Pyruvate metabolism
    HTH_0077 (acs)
   00640 Propanoate metabolism
    HTH_0077 (acs)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HTH_0077 (acs)
   00680 Methane metabolism
    HTH_0077 (acs)
Enzymes [BR:hth01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HTH_0077 (acs)
Lipid biosynthesis proteins [BR:hth01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HTH_0077 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
79637..81532
Genome map
AA seq 631 aa AA seqDB search
MVEDRSETLLKVEEKYMPPPSIVESAWVRDYETLYQESIKDREAFWAKVAEDLHWFKKWD
KVLEWNYPYAKWFVGGKTNITYNCLDRHVKNGKRNKVAYIALDEDSREKKITYGELLELV
NRIANGLKSLGVKKGDRVSIYMPNTVEAVACMLACARIGAIHSLVFAGFSEGALRLRIED
AKAKVVITASYTKRRGKKIDLLATAQRAIDGLDFVEKVIVWDRDGDVLNGEDKFFVSLDE
LISTSSPKCEPEVMDAEDPLYILYTSGTTGKPKGVLHTTGGYMVGTYYTTKVVFDLKEDD
IYWCTADIGWVTGHSYIVYGPLAVGATSLIVEGAPDYPDPGRWWSYVEKYRVNIFYTAPT
AVRMFMKYGEQWPAKYDLSSLRILGSVGEPINPEAWHWYFKNIGREKCVIVDTWWQTETG
MHMITTIPSYPAKPGKAGKPFFGIEALVVDRHGNVLPPNTIGNLVIKTPWPSMLRTCWGE
PERYEKYWNTIPGYYLTGDLASYDEEGYIMILGRADDVLNVAGHRIGTMEVESAIVDYPA
VAEAAVIGKPHEVKGESIKAFVILKKGYEPSEKLVEEIKYHVKQVLGPIAVPDEIEFVEK
LPKTRSGKIMRRVLKAQELGLPVGDISTLED
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggtggaagataggtctgagacacttttaaaagttgaggaaaagtacatgcctcctccg
tctatagtagagtccgcatgggtgagggattatgaaaccctataccaggaatccattaag
gacagagaagctttctgggcaaaggttgcggaggacctgcactggtttaaaaagtgggat
aaggttttggaatggaactatccatatgccaagtggttcgtaggaggaaaaactaacata
acttataactgccttgacaggcatgtaaaaaatggcaagaggaataaggtagcctacata
gcccttgatgaggacagcagggaaaagaaaattacttatggagagcttttggaacttgta
aatcgtatagccaacggacttaagtctcttggagttaaaaagggtgatagggtttccata
tacatgcctaatacggtagaagcagttgcatgtatgttggcatgtgcaaggataggagct
atacacagtctggtttttgcaggctttagtgaaggtgctttgaggctcaggatagaggat
gcaaaagcaaaggtggttataacagcaagttatactaagagaaggggtaaaaagatagac
ctgcttgcaactgcacagagggcaatagatggtcttgactttgtagaaaaagttatagtt
tgggacagggatggcgatgtgctaaatggggaggacaagttctttgtgagtcttgatgag
cttataagcaccagctcacccaagtgcgagccagaagttatggacgctgaggaccctctt
tacatactttacacatctggaactacaggcaagccaaagggtgtgctacacaccacaggt
ggctacatggtgggaacatactacaccacaaaggtggtttttgacctcaaagaggatgat
atatactggtgtaccgcagatataggctgggtgacaggacacagctacatagtgtatggt
ccacttgctgtgggtgccacatctctaatagtggaaggagcacccgattaccctgacccg
ggaaggtggtggagctatgtagaaaagtacagagttaacatcttttacaccgcgcctacg
gcggtaagaatgtttatgaagtacggtgagcagtggcctgccaagtatgacctctcttcg
ctgaggatattgggctcggttggtgaacccataaacccggaagcgtggcactggtacttt
aagaacataggaagagaaaagtgcgtcatagtggacacctggtggcagacagaaacaggc
atgcacatgataaccaccataccttcttaccctgcaaaaccgggtaaggcaggcaaaccc
ttctttggcatagaggctcttgtagtggacagacacgggaatgtcctcccccccaacacc
ataggcaacctcgttataaaaacaccctggccttctatgctcagaacctgctggggagag
ccagagaggtacgaaaagtactggaacaccatacccggatactatctgacaggagaccta
gcttcttatgacgaggagggatacataatgattctgggaagggctgacgatgtgctaaat
gttgcaggacacaggataggaactatggaagtggaaagcgccatagtggactatcctgct
gtggctgaagctgcagttatcggaaaaccccacgaggttaagggagaatctataaaggct
tttgtgatactcaagaagggttatgagccatctgaaaagctcgttgaggaaataaagtac
catgtgaagcaggtgctgggacctatagcggtgcctgacgagatagagtttgttgaaaag
cttcccaagaccagaagcggaaagataatgagaagagttctaaaggctcaggagcttggg
cttccggttggagacatatccacccttgaggactga

DBGET integrated database retrieval system