KEGG   Hydrogenobacter thermophilus: HTH_0165Help
Entry
HTH_0165          CDS       T01167                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HTH_0165
Enzymes [BR:hth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HTH_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
170955..171596
Genome map
AA seq 213 aa AA seqDB search
MGCLFVLSAPSGAGKTTVAEKLIREVSGIKRVVTATTRSKREGEREGVDYIFMSREEFER
GIKDSIFLEYASVYGNYYGTPKEQVKKVLEEGFDALLVIDVQGAKSIKDKLPESILIFLL
PPSLEELKRRLITRGYAEENLLEREKKVEVEIACARHFDYIVVNDFLDKAVEAIKHIVNS
YRHTKERVFKDIEKLVKDDTIKDILLKGRCDIF
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtctttttgttctctcagcaccatctggagcaggcaaaaccactgtggcggaa
aagctcatcagagaagtttctggtattaaaagggtggtgactgcaacaacaagatcaaaa
agggaaggagagagagaaggtgtggactatattttcatgagcagggaggagtttgagagg
ggtataaaggatagcattttccttgagtatgcctccgtgtatggcaattactacggcact
ccaaaggagcaggtaaaaaaggtgttagaggagggttttgacgctcttctggttatagat
gtgcaaggtgcaaagagcataaaggataaactcccggaaagtattcttattttccttctg
cctccatctcttgaggaactaaagaggcgtctcatcacacgagggtatgcggaggaaaac
cttctggagagggagaagaaagtggaagtagaaatagcctgtgccaggcactttgattac
atagtggtcaacgattttcttgacaaggctgtggaagccataaagcacatagtaaattct
tacagacacacaaaggagagggtgtttaaagacatagaaaagctcgtcaaagatgatact
ataaaggatatactgctcaaaggcaggtgtgatatcttttaa

DBGET integrated database retrieval system