KEGG   Hydrogenobacter thermophilus: HTH_0275Help
Entry
HTH_0275          CDS       T01167                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hth00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(277959..279389)
Genome map
AA seq 476 aa AA seqDB search
MRLAGILLHITSLPSSFGVGDLGPTAYEFVDFLEASGQKLWQILPLNPTCMEFGNSPYFS
ISLFAGNPLLISLELLCKEGLLSDKDIQRAKFQSDRVDYERASRIKMELLEKAFSNFSQT
PEYLSFEEENGYWLEDYCRFKVLRDRFKKPWREWESESVKELELQIKKEKFFQFLFFKQW
KTLKAYANSKEIRIMGDLPIYPAFDSSDVWSHRDLFKLDENNMPYVVAGVPPDYFSPTGQ
LWGNPVYNWDRLKETGFHWWIERIRHNLKLFDLLRLDHFRGFVAYYEVPASEKTAIVGRW
VNAPAEEFFAKLKREFPDFPFVAEDLGLITPDVERIRDSFGFPGMKVLAFAFEEDNHPFM
PHNHQKNSFVYTGTHDNAPIRSWFLEELSSASKERLFRYLGRAVDEEQVSDVLIRLAYMS
VAKACVIPMQDILNLGKEARMNTPGKKEGNWEWKLKSIPDEKVAQRLRELCTTYGR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gtgaggttggcaggtatacttttgcatataacttctcttccctcatcctttggggtcgga
gaccttggtcctaccgcttatgagtttgtggattttttggaagcttcgggacagaagctt
tggcagatacttcctctgaaccccacctgcatggagtttggaaactctccctactttagc
atatctctatttgcaggcaacccattgcttataagtcttgaacttctttgcaaagaaggg
cttctctcagataaggatattcagagagctaagttccaaagtgatagggtggattatgag
agggcatcaaggataaagatggagcttctggagaaggcttttagtaattttagtcaaacg
cctgagtatctgtcttttgaagaagaaaacggctactggcttgaggattactgcaggttt
aaggttctcagagacaggtttaaaaaaccttggagagagtgggaaagtgagagtgtaaaa
gagcttgaacttcagataaagaaagaaaagttttttcagtttttgtttttcaaacagtgg
aaaactcttaaagcttacgccaattctaaagagataaggataatgggagaccttcccatc
tatcctgcctttgacagcagtgatgtgtggtctcacagggaccttttcaagcttgatgaa
aacaatatgccatatgtggtggcaggcgttccacccgattactttagtcccacaggtcag
ctctggggaaatcctgtttataactgggacaggctgaaggaaacagggtttcattggtgg
atagagaggattaggcataacctaaagctctttgaccttttaagacttgaccacttcagg
ggttttgtggcttactacgaggtgccagcttctgaaaaaacggctatagtaggcaggtgg
gtgaatgctcctgcggaagagtttttcgcaaagctaaagagagagtttcctgactttcct
tttgttgcagaggaccttgggcttataacgccagatgtggaaagaatcagggacagcttt
ggttttccgggtatgaaggtgcttgcctttgcttttgaggaggataaccatccctttatg
cctcacaatcaccagaaaaattccttcgtttacacaggcactcacgacaatgcacccata
aggtcctggtttttggaggagctaagcagtgcttcaaaggagagactctttagatacctg
ggaagagcagttgatgaagagcaggtaagtgatgttcttataaggcttgcttacatgtcc
gtggctaaagcttgcgtgattcctatgcaggatattctcaatcttggtaaagaggcaaga
atgaacacaccgggaaagaaagaaggcaattgggagtggaaactaaaaagcatacccgat
gaaaaggtagcgcagagactaagagagctttgcaccacctatggaaggtaa

DBGET integrated database retrieval system