KEGG   Hydrogenobacter thermophilus: HTH_0331Help
Entry
HTH_0331          CDS       T01167                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hth00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hth00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
335091..336380
Genome map
AA seq 429 aa AA seqDB search
MKSITSYTSDYLVIEGGHRLVGKVRISGSKNASLPIMMSSLLTDDVCYIEDVPDLLDVRS
TIELLQVFNAEVSYHQGKLRLDASKIKSFIAPDYIVRRMRASVLAMGPLLGRFGKAVVAM
PGGCSIGVRAIDQHLKVFERGGARINVQHGYVHLEVDKIKPVEYTFEVVTVTGTENALMF
LSRCEKRSILRNIAIEPEVMDLVEVLRSMGVSIEIDGRTAIVRGSRELKGFAHRVIPDRI
EAGTFLVAGFITGGDIELENVRVDHLGSVIEKLREAGACVEVSSDRIRVYSNGGGIKPLS
ISTSEYPGFPTDMQAQFTSMCCLAEGLSEITENIFENRFQHVAELQRMGADIHIRGRTAF
IKGVKKLTGAEVFSTDLRASASLVLAGLVAEGKTVVRDIYHLDRGYERLDEKLKSLGAPV
ERHSITDVI
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcatcacatcatatacttctgattacttggttatagagggaggacacagatta
gtaggtaaggtgaggatttcaggctccaaaaacgcatctttgcctataatgatgagcagt
ttgcttactgatgatgtatgttatatagaggatgttcccgaccttcttgatgtaagaagc
actattgagcttttgcaggtgtttaatgcagaggtatcctatcatcaaggtaaattgaga
ttggatgcttcaaagataaagagctttatcgcacctgactacatagtgaggaggatgagg
gcatctgtgcttgccatgggacctcttttgggaagatttggtaaagctgtagtagcaatg
cccggtgggtgttccataggtgtaagagccatagatcaacacttaaaagtatttgagaga
ggtggggctcgtataaatgtacagcacggctatgttcatcttgaggtggacaaaataaag
cctgttgagtatacctttgaggtggtgacagtgacaggtaccgaaaacgcacttatgttt
ttaagcagatgtgaaaagagaagcatacttagaaacatagctatagagcctgaagtcatg
gacctggtggaggtcctaagaagcatgggtgtaagcatagagatagatggtaggactgcc
atagtgaggggaagcagagagcttaaaggttttgctcacagagttataccagacaggata
gaggcgggtactttcttggtggcgggttttataacaggtggagatatagagcttgaaaat
gtgcgcgttgatcatttaggtagcgtgatagaaaaactcagagaggcgggagcttgcgtt
gaagtatcttctgatagaatcagagtttattctaatggagggggtataaaacctctctct
atatctacttccgaatatcctggctttcctacggatatgcaggctcagtttacatccatg
tgctgtctggcagagggcttgtcagagataacggaaaacatctttgaaaataggtttcaa
catgtggcagagcttcagagaatgggtgcggatatacacataaggggaagaacagctttt
ataaagggtgtaaaaaagcttaccggtgcagaggttttctcaacggaccttagagcttct
gccagtttagtccttgcaggtttggtagcagaagggaaaacggtggtaagggatatatat
caccttgacaggggatacgagagacttgatgaaaagttaaaaagcttaggagcgcctgta
gagaggcactccattactgatgtcatttga

DBGET integrated database retrieval system