KEGG   Hydrogenobacter thermophilus: HTH_0340Help
Entry
HTH_0340          CDS       T01167                                 

Definition
(GenBank) putative fructose 1,6-bisphosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
hth  Hydrogenobacter thermophilus
Pathway
hth00010  Glycolysis / Gluconeogenesis
hth00030  Pentose phosphate pathway
hth00051  Fructose and mannose metabolism
hth00680  Methane metabolism
hth01100  Metabolic pathways
hth01110  Biosynthesis of secondary metabolites
hth01120  Microbial metabolism in diverse environments
hth01130  Biosynthesis of antibiotics
hth01200  Carbon metabolism
hth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HTH_0340
   00030 Pentose phosphate pathway
    HTH_0340
   00051 Fructose and mannose metabolism
    HTH_0340
  Energy metabolism
   00680 Methane metabolism
    HTH_0340
Enzymes [BR:hth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     HTH_0340
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     HTH_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: BAI68806
UniProt: D3DG54
Position
complement(344556..345701)
Genome map
AA seq 381 aa AA seqDB search
MRITLSVIKADVGGYVGHSGVHPQLVETIKEFVQEEVKKGILIDASVLVCGDDTAIVMTH
THGVDSEIVHGIAWRAFEKATEVAKKLKLYGAGQDLLSTAFSGNVKGMGPGVAEMEFEER
PSEPVIVFFADKTAPSAWNLPLYEMFADPMVCAGLVIDPKMHDGFTFEVLDTYTGKAVKL
STPSELYELLALIGTVERYAIRSVWRNNDGEIAAVASTQRLSLIAGKYVGKDDPVMVVRA
QAGFPAVGEILEPFARPWIVEGWMRGSHNGPLMPVSFKNATPTRFDGPPRVIAAGYQIAE
GKLIGPRDLFDDPAFDKAREQAQLMADMLRRQGIFEPHRLPSEEMEYTTLPKILKKLEER
FYELEAPRKAVEDPVEKHDID
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaggataacactgagcgttataaaagcggatgtaggaggttatgtggggcactctggg
gtacatccacagctggtggaaaccataaaagagtttgttcaggaggaagtaaagaaggga
attttaattgatgcgagtgtgcttgtatgcggggatgataccgctatagttatgacgcat
actcacggtgttgacagtgagatagttcatggtatagcctggagggcttttgagaaggca
acagaagttgccaaaaaattaaaactctacggtgcaggacaggatcttctttccacagcc
ttttctggtaatgttaaaggtatgggtccgggtgttgcagaaatggagtttgaagaaaga
ccctctgaacctgtcatagtcttctttgccgataaaacggctcccagcgcatggaatctt
cccctttacgagatgtttgctgaccctatggtgtgtgccggacttgtgatagaccccaag
atgcacgacggctttacctttgaagttcttgacacatatacaggtaaagccgtaaagctc
tctactccttcagagctttatgaacttttagctcttataggcacggtggagagatacgcc
atcagaagcgtctggaggaataatgacggcgagatagctgcggttgcctcaactcagagg
ctctccctcatagctggcaagtatgtgggtaaagatgaccctgttatggtagtcagggcg
caggcggggttccctgcagtaggtgaaatattagaaccctttgcaagaccttggatagtg
gagggttggatgagaggctctcacaacggacctctcatgccagtatccttcaaaaatgct
acacccaccaggtttgacggacctcccagagtgatagccgcaggataccagatagcggaa
ggcaaactgataggtcccagggatctctttgacgaccctgcctttgacaaggcaagggag
caggcacaactgatggcagacatgctcagaagacagggtatctttgaaccccacagattg
ccatcagaagagatggaatatactaccctccccaaaatactcaaaaagctcgaagaaaga
ttttacgaattggaagctcccagaaaagcagtggaagacccagttgaaaaacacgatata
gattaa

DBGET integrated database retrieval system