KEGG   Hydrogenobacter thermophilus: HTH_0340Help
Entry
HTH_0340          CDS       T01167                                 

Definition
putative fructose 1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HTH_0340
   01230 Biosynthesis of amino acids
    HTH_0340
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HTH_0340
   00030 Pentose phosphate pathway
    HTH_0340
   00051 Fructose and mannose metabolism
    HTH_0340
  Energy metabolism
   00680 Methane metabolism
    HTH_0340
Enzymes [BR:hth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     HTH_0340
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     HTH_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(344556..345701)
Genome map
AA seq 381 aa AA seqDB search
MRITLSVIKADVGGYVGHSGVHPQLVETIKEFVQEEVKKGILIDASVLVCGDDTAIVMTH
THGVDSEIVHGIAWRAFEKATEVAKKLKLYGAGQDLLSTAFSGNVKGMGPGVAEMEFEER
PSEPVIVFFADKTAPSAWNLPLYEMFADPMVCAGLVIDPKMHDGFTFEVLDTYTGKAVKL
STPSELYELLALIGTVERYAIRSVWRNNDGEIAAVASTQRLSLIAGKYVGKDDPVMVVRA
QAGFPAVGEILEPFARPWIVEGWMRGSHNGPLMPVSFKNATPTRFDGPPRVIAAGYQIAE
GKLIGPRDLFDDPAFDKAREQAQLMADMLRRQGIFEPHRLPSEEMEYTTLPKILKKLEER
FYELEAPRKAVEDPVEKHDID
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaggataacactgagcgttataaaagcggatgtaggaggttatgtggggcactctggg
gtacatccacagctggtggaaaccataaaagagtttgttcaggaggaagtaaagaaggga
attttaattgatgcgagtgtgcttgtatgcggggatgataccgctatagttatgacgcat
actcacggtgttgacagtgagatagttcatggtatagcctggagggcttttgagaaggca
acagaagttgccaaaaaattaaaactctacggtgcaggacaggatcttctttccacagcc
ttttctggtaatgttaaaggtatgggtccgggtgttgcagaaatggagtttgaagaaaga
ccctctgaacctgtcatagtcttctttgccgataaaacggctcccagcgcatggaatctt
cccctttacgagatgtttgctgaccctatggtgtgtgccggacttgtgatagaccccaag
atgcacgacggctttacctttgaagttcttgacacatatacaggtaaagccgtaaagctc
tctactccttcagagctttatgaacttttagctcttataggcacggtggagagatacgcc
atcagaagcgtctggaggaataatgacggcgagatagctgcggttgcctcaactcagagg
ctctccctcatagctggcaagtatgtgggtaaagatgaccctgttatggtagtcagggcg
caggcggggttccctgcagtaggtgaaatattagaaccctttgcaagaccttggatagtg
gagggttggatgagaggctctcacaacggacctctcatgccagtatccttcaaaaatgct
acacccaccaggtttgacggacctcccagagtgatagccgcaggataccagatagcggaa
ggcaaactgataggtcccagggatctctttgacgaccctgcctttgacaaggcaagggag
caggcacaactgatggcagacatgctcagaagacagggtatctttgaaccccacagattg
ccatcagaagagatggaatatactaccctccccaaaatactcaaaaagctcgaagaaaga
ttttacgaattggaagctcccagaaaagcagtggaagacccagttgaaaaacacgatata
gattaa

DBGET integrated database retrieval system