KEGG   Hydrogenobacter thermophilus: HTH_0483Help
Entry
HTH_0483          CDS       T01167                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hth00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
475161..476147
Genome map
AA seq 328 aa AA seqDB search
MEFPKLRPRRLRSNESIRRLVRETKLSLDDLICPVFVRYGEGIEEEVPSMPGVFRYSPDK
VIDEVKKIRDLGIPAIILFGIPEHKDEVGSDTWSKEGIIQRTVRLIKKEVPDIYVITDVC
FCEYTTHGHCGVLKNHHVDNDATLENLKKQAVSHAESGADMLAPSGMMDGMVKAIRSALD
EANFYEIPIMAYSAKFASAFYGPFRDAAQSAPAFGDRRTYQMDPSNAREALKEVLLDLQE
GADIVMVKPALSYLDIIYRVKEATLLPVCAYNVSGEYSMIKAAGKLGWIDERKVMWEVLT
SIKRAGADMIITYFAKDVAILINRGELA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggagtttccaaagctaagacctcgcaggctgaggagtaatgagagcataaggcgtttg
gttagagagaccaagctgagtcttgacgaccttatatgccctgtttttgtgcgctacgga
gagggtattgaagaagaagtgccttctatgccgggagttttcagatacagtcccgacaaa
gtgattgatgaagttaaaaagataagggatttgggcattcctgccataatactctttggt
attccagagcacaaggacgaggttggatcagatacatggagcaaagaaggtataatccag
aggactgtaaggcttataaaaaaagaggtaccagacatttatgtaattacggatgtgtgc
ttctgtgagtacaccacccatggacactgcggagtgctcaaaaaccaccacgttgacaac
gatgctacgcttgaaaatctcaaaaaacaagctgtatctcatgcagaaagcggggctgat
atgctggcaccttctggtatgatggacggtatggtaaaagctataaggagtgctttagat
gaggctaacttttatgagattcccataatggcatactctgccaagtttgcctctgccttt
tacggacccttcagagatgctgcgcagtcagcaccagcctttggcgatagaagaacttac
cagatggacccgtccaacgcaagagaagccttaaaggaagtgcttttggaccttcaagaa
ggtgcagacatagttatggtaaagccagccctatcttacttggatattatttaccgcgta
aaggaggctacactgcttccagtatgcgcttacaatgtgagcggtgagtattctatgata
aaggcagccggaaagcttggatggatagacgaaaggaaagttatgtgggaggtgctaact
tctataaagcgtgctggtgcggatatgatcatcacttactttgctaaagatgtggctatt
ttaataaacagaggtgagttggcatga

DBGET integrated database retrieval system