KEGG   Hydrogenobacter thermophilus: HTH_0598Help
Entry
HTH_0598          CDS       T01167                                 

Gene name
glnS
Definition
glutamyl- and glutaminyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:hth00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
562547..563959
Genome map
AA seq 470 aa AA seqDB search
MVITRFAPSPTGYLHLGNARTAIFSYLFARHHRGKFILRIEDTDLERSTKEFEAMLLEDL
KWLGLDWDEFYRQSERFDIYREYAQRLIELGHAYPCFCTPEELSIERQEAEKKGIPYRYS
GKCRVLDKKQVEELKESGKSYTIRFKVPYGEYVVFEDLIKGHIAINTDDFGDFVIIRSDG
TPTYNFVVVIDDALMGITHVIRGEDHIPNTPKQILIYRALGFDVPKFAHLPVILGEDRSK
LSKRHGAVSVRNYREEGYLPQALFNYLCLLGWSSPQEGKEIYSKEELIEIFDLKDINTSP
AVFSKEKLRWMNGVYIREVLSLEELIDGITPFLKQAGYDVSDRDYLKRVLEKTRDSFETF
KEAGDRLKPFFVDDFDISQDAWSELENARVYDILSVFLEKIKDRQLNAQSVKEMAREIQK
ELNVKAKDVWHSLRIALTGELEGVGVDILCDILPKEKIVLRVERLLKKIA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggtaatcacaaggtttgccccaagtccaacaggatacctgcacttgggtaatgcaagg
acggccatttttagctacctctttgcacgccaccacagaggaaagttcatacttagaata
gaagacacagatttagaaaggtctacaaaagagtttgaggctatgctccttgaagacctc
aaatggctgggtcttgattgggacgaattttacagacagtccgagaggtttgacatttac
agagagtatgcacaaagactcatagagttaggacacgcatatccatgcttttgcactcca
gaagagctaagcatagaaagacaagaggctgaaaagaaaggcataccttacagatactcg
ggaaaatgcagagttctggataagaagcaggtggaggagctaaaagaaagtggcaaatct
tacactatacgctttaaggtgccttacggagagtacgtagtctttgaagacctcataaag
ggacacatagccataaacaccgatgactttggggactttgtgataataagaagcgatgga
acacctacctataactttgtggtagttattgacgatgcactcatggggataacgcatgta
ataaggggagaggaccacatacccaacacacccaaacagatactaatatacagggcgctt
ggctttgatgtgcctaagtttgcgcacctgcctgtcatactcggtgaagacaggagcaag
ctttccaaaaggcatggagcggtttctgtaagaaactacagagaggagggataccttccc
caagcgctttttaattacctgtgtcttttaggttggtcttcaccccaagaaggcaaagaa
atatacagcaaggaggagctcatagaaatatttgacctaaaagacataaacacatcccca
gccgttttcagcaaagaaaaactcagatggatgaatggagtttacataagagaagtgcta
agcctggaggagctaatagatggaataacacctttcttaaagcaagcgggttatgatgtt
agcgacagagattatcttaaaagggtgcttgaaaagacaagagactcctttgaaaccttt
aaggaagctggtgatagactaaaacccttctttgttgatgattttgatatatctcaggat
gcatggagcgagcttgaaaatgcaagggtgtacgatatactctctgtattcttagagaag
ataaaagataggcaacttaatgcccagagtgtaaaggagatggccagagaaatacaaaag
gagcttaatgtaaaagctaaggatgtgtggcactctctcaggatagccctaacaggtgag
ctggaaggtgtaggcgtagacatactttgcgatatcctgcctaaggagaagatagtattg
agggtggagcgtctccttaaaaagatagcatga

DBGET integrated database retrieval system