KEGG   Hydrogenobacter thermophilus: HTH_0600Help
Entry
HTH_0600          CDS       T01167                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HTH_0600 (galU)
   00052 Galactose metabolism
    HTH_0600 (galU)
   00500 Starch and sucrose metabolism
    HTH_0600 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HTH_0600 (galU)
Enzymes [BR:hth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HTH_0600 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
565061..565951
Genome map
AA seq 296 aa AA seqDB search
MQVRKAVLPVAGWGTRFLPATKAMPKEMFPIIDKPVIQFIVEECISADIENIIFVTGRHK
RPIEHHFDINTDLEKHLEQCGKMDLLRNIMEISRLINPIYVRQKEQLGLGHAVLVAEPVV
GYEPFVVALGDIIIKDERNVLERMIEVYNRFGKSVIAVFEVDLKDVSKYGIVDGRLIERD
IYIVDHLIEKPKPEEAPSHLAIVGRYLFTPRIFEKLKITPPGKGGEIQLTDAIRLLIEDE
AVYAIKIDAKVYDTGTPLGYIQTVLDFALQRDDIRDDLISYLRQLLSNNIPQIDTV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaagaaaggcggtcttacctgtagcaggttggggcacaaggtttttacctgcc
accaaggctatgcccaaggagatgtttccaataatagacaagcctgtcatacagtttatc
gttgaagaatgcatctctgcagacattgagaacattatattcgtcacagggaggcataaa
aggcccattgaacaccactttgatataaacacagatttggaaaagcatctagaacagtgt
ggaaagatggaccttttgaggaacataatggaaataagtaggttgattaatcccatatat
gtaagacagaaggaacagcttggacttggtcatgcagtattggtagctgaacccgtggta
ggctatgaaccttttgtggtagctcttggggatatcatcatcaaggatgagaggaacgta
cttgagagaatgatagaagtatacaaccgctttggtaagagtgtaatagcagtttttgaa
gtggaccttaaggatgtttccaagtacggtatagtagacggcagacttatagagagggat
atatacattgtagaccatcttatagaaaaaccaaagccagaggaggcaccctctcatctt
gccatagtaggcaggtacctttttacaccgaggatctttgaaaaacttaaaataacacct
cccggaaagggcggagagatacagctcaccgatgctataaggttgcttattgaggacgaa
gctgtttatgcaatcaagatagatgctaaggtttacgatacgggaacacctctcggatat
atacagacggtccttgactttgctttgcaaagagatgacatcagagatgacctcatatct
tacttgaggcagctcctcagtaataatatcccacagatagatacagtctga

DBGET integrated database retrieval system