KEGG   Hydrogenobacter thermophilus: HTH_0611Help
Entry
HTH_0611          CDS       T01167                                 

Gene name
timA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HTH_0611 (timA)
   01230 Biosynthesis of amino acids
    HTH_0611 (timA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HTH_0611 (timA)
   00051 Fructose and mannose metabolism
    HTH_0611 (timA)
   00562 Inositol phosphate metabolism
    HTH_0611 (timA)
Enzymes [BR:hth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HTH_0611 (timA)
Exosome [BR:hth04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HTH_0611 (timA)
  Exosomal proteins of bladder cancer cells
   HTH_0611 (timA)
  Exosomal proteins of melanoma cells
   HTH_0611 (timA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(577610..578350)
Genome map
AA seq 246 aa AA seqDB search
MKLISANWKMNMTPSQTKEYLYNFLPLVEDVKDREILLCVPYTSLCIASEMLKDKHVKFG
AQNVHYEPKGAFTGEISVSMLKDLGVSYVIVGHSERRWLFGESDEIINKKLIACLGSGIR
PILCVGERQDEREAGLTFKVIETQVKLALSSLEDYTDMIDIAYEPVWAIGSGNPATPEDA
QKVHRFIKELLESLNKNYKGTTRILYGGSVNIHNASEFMKMPDIDGLLVGGASLDPEAFS
QIVKSF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcatctctgccaactggaaaatgaatatgaccccttctcagaccaaagagtat
ctgtataactttttaccacttgttgaagatgtaaaagacagggagatacttctgtgcgtg
ccatacacttctctgtgtattgcttctgaaatgcttaaagataaacatgtaaagtttggc
gctcaaaatgtgcattatgaaccgaagggagcctttacaggagagatatcggtcagtatg
ctcaaggacttgggggtgtcttatgtaatagtgggtcattcagagagaaggtggcttttt
ggtgaaagtgatgaaataatcaacaaaaagttaatagcttgtcttggcagtggtataaga
cccatactttgcgttggggaaaggcaggacgagagggaggcagggctcacctttaaggta
attgagacgcaggttaaacttgcgctgtcttctctggaagactatacggatatgatagac
atagcctacgagcctgtttgggcaatagggagtgggaatcccgccacacccgaggatgca
cagaaggttcacagatttataaaagaactacttgaaagcttaaacaaaaattataaaggt
actacacgcattctttacggtggaagcgtaaacatccataatgccagtgagttcatgaag
atgccggacatagacgggcttttggtaggtggtgccagcttagaccctgaagccttttcc
cagatagtaaagtccttttag

DBGET integrated database retrieval system