KEGG   Hydrogenobacter thermophilus: HTH_0611Help
Entry
HTH_0611          CDS       T01167                                 

Gene name
timA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:hth01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hth01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hth00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hth00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hth00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(577610..578350)
Genome map
AA seq 246 aa AA seqDB search
MKLISANWKMNMTPSQTKEYLYNFLPLVEDVKDREILLCVPYTSLCIASEMLKDKHVKFG
AQNVHYEPKGAFTGEISVSMLKDLGVSYVIVGHSERRWLFGESDEIINKKLIACLGSGIR
PILCVGERQDEREAGLTFKVIETQVKLALSSLEDYTDMIDIAYEPVWAIGSGNPATPEDA
QKVHRFIKELLESLNKNYKGTTRILYGGSVNIHNASEFMKMPDIDGLLVGGASLDPEAFS
QIVKSF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcatctctgccaactggaaaatgaatatgaccccttctcagaccaaagagtat
ctgtataactttttaccacttgttgaagatgtaaaagacagggagatacttctgtgcgtg
ccatacacttctctgtgtattgcttctgaaatgcttaaagataaacatgtaaagtttggc
gctcaaaatgtgcattatgaaccgaagggagcctttacaggagagatatcggtcagtatg
ctcaaggacttgggggtgtcttatgtaatagtgggtcattcagagagaaggtggcttttt
ggtgaaagtgatgaaataatcaacaaaaagttaatagcttgtcttggcagtggtataaga
cccatactttgcgttggggaaaggcaggacgagagggaggcagggctcacctttaaggta
attgagacgcaggttaaacttgcgctgtcttctctggaagactatacggatatgatagac
atagcctacgagcctgtttgggcaatagggagtgggaatcccgccacacccgaggatgca
cagaaggttcacagatttataaaagaactacttgaaagcttaaacaaaaattataaaggt
actacacgcattctttacggtggaagcgtaaacatccataatgccagtgagttcatgaag
atgccggacatagacgggcttttggtaggtggtgccagcttagaccctgaagccttttcc
cagatagtaaagtccttttag

DBGET integrated database retrieval system