KEGG   Hydrogenobacter thermophilus: HTH_0670Help
Entry
HTH_0670          CDS       T01167                                 

Definition
transcriptional regulator, NagC/XylR family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HTH_0670
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HTH_0670
   00052 Galactose metabolism
    HTH_0670
   00500 Starch and sucrose metabolism
    HTH_0670
   00520 Amino sugar and nucleotide sugar metabolism
    HTH_0670
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HTH_0670
   00524 Butirosin and neomycin biosynthesis
    HTH_0670
Enzymes [BR:hth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HTH_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(630957..631832)
Genome map
AA seq 291 aa AA seqDB search
MRKGVDIGGTFIKVLWEDGRRQKFYVKDISRDGEKFIKTIVSVVKEGEPEAVGIAVAGFT
SLEGVVYKSPNIPALDGLNLKEIITSEGIKCIVGNDVSFGAFGEWYYDHRESKSLLFIAI
GTGLGAGFVINGEPYLGACGSSLELGHHIIKVGGELCNCGRAGCWEAYCSSYGFERIYKS
ISQEYLRDYQVVEKAKQGDQTALSAVEVFKEYLIAGLVNAVHILNPDVLVLGGGLLDSMR
EFLGDVKERLLASVEKLPASCLSVAFSSCEEFCMARGALAMSLKLFEQSSP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagggggttgacataggaggcacctttataaaggtgctctgggaagatgggagg
aggcagaagttttatgttaaggacatttcaagagatggggagaagtttataaagaccatc
gtaagtgtggtaaaggagggagagcctgaggctgtggggattgctgtggcgggttttacg
tctcttgaaggcgtagtttacaagtctcccaacataccagctcttgacgggctgaacctg
aaagagattataacctccgagggtataaagtgcattgtgggcaacgatgttagctttgga
gcctttggtgagtggtattatgaccacagagagagcaaaagtctcctctttatagctata
ggtacaggattgggagcggggtttgtcatcaacggggagccttaccttggagcctgcgga
agcagtttagagctggggcatcacatcataaaggtgggtggggagctttgcaactgcgga
agggctgggtgctgggaagcttactgttcctcttacggctttgaaaggatatacaagagc
atctcgcaggaatacttgagagattaccaagtggtagaaaaagccaaacagggggaccag
acggctctgagtgcagtggaagttttcaaagaatacctgatagcgggacttgttaatgcg
gtgcatatactcaatccggatgtgctggttcttggtggtgggcttttggacagtatgagg
gagtttctgggtgatgtaaaagagaggcttctggcatcggtggagaagcttccagcctct
tgtctttctgtggcattttccagctgtgaggagttttgcatggcaaggggagctcttgct
atgagcttaaagctttttgaacaatcctctccttag

DBGET integrated database retrieval system