KEGG   Hydrogenobacter thermophilus: HTH_1036Help
Entry
HTH_1036          CDS       T01167                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HTH_1036 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HTH_1036 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HTH_1036 (trpB1)
Enzymes [BR:hth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HTH_1036 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
946662..947870
Genome map
AA seq 402 aa AA seqDB search
MVMHLPDERGYFGSFGGKFVPETLMYALEELDIEYKKAKSDKRFWEELNYYLRTYAGRPT
PLYFARNLTEYAGGAKIYIKREDLLHTGAHKINNTLGQALLTKRMGKRRVIAETGAGQHG
VATATVCALLGLDCVVYMGEEDAHRQELNVFRMKLLGADVKVVKSGSKTLKDAINEALRD
WVTNVETTHYIIGSVVGPHPFPLMVRDFQKVIGEETREQILELEGRLPDAVVACVGGGSN
AMGIFYPFLEDERVRLVGVEAGGLGLKTGKHAASINGGSVGVLHGMKSYFLQDEEGQILP
THSVSAGLDYPGVGPEHAYLFESKRAQYTYATDEEALEGFKLLSKLEGIIPALEPAHAIL
KVISLAREIGKGGIVILNLSGRGDKDTYHVMKLLKEVQDAQV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggttatgcacttacctgacgaaaggggatactttggaagttttggaggtaaatttgtt
ccagaaacgcttatgtacgctcttgaggagcttgatattgaatataagaaagcaaaatct
gacaaaagattttgggaagagctaaattactaccttagaacctacgcaggtagacccaca
cctctatactttgccagaaatctgaccgagtatgcggggggtgccaaaatatacataaag
agagaggaccttctgcacactggtgcccacaaaataaataacactcttgggcaggcgcta
cttaccaagaggatgggtaaaagaagagttatagcggaaacgggggcaggtcagcacggt
gttgctactgcaacagtctgtgcccttttgggtcttgattgcgtagtttacatgggtgag
gaagatgcgcatagacaggagctaaatgtatttagaatgaaactccttggtgcggatgta
aaagttgtaaagagtggaagcaaaaccttaaaggatgccataaacgaagcactgagagac
tgggtaaccaacgtggagactactcactacattataggttcagttgtaggtccccatcct
tttcccctcatggtaagggattttcaaaaggtaataggagaggaaacgagggagcaaata
cttgagctggagggaagactacccgatgcggtggttgcgtgtgttgggggaggttccaac
gctatgggtattttctatccctttttggaggacgaaagggtcaggctcgtgggggtagaa
gccggcggtttaggcttaaaaacaggcaagcatgcagcctccataaacggtggaagtgtg
ggtgtacttcacggtatgaagtcttactttttacaggacgaagaaggtcagatactacct
actcactctgtatccgcaggcttggattatccaggagttggtcccgagcatgcctatctc
tttgaaagcaagagagctcagtacacttatgcaaccgatgaagaagctctggaaggcttt
aaacttctgtcaaagcttgaaggtattattcccgccttagagcctgcccacgcaatcctc
aaagtgataagccttgcaagggagatagggaaaggtgggattgtcatattaaacctctcg
ggaaggggagataaggacacgtatcatgtgatgaaactgctcaaagaagttcaagacgca
caggtttaa

DBGET integrated database retrieval system