KEGG   Hydrogenobacter thermophilus: HTH_1065Help
Entry
HTH_1065          CDS       T01167                                 

Gene name
trpB2
Definition
tryptophan synthase beta subunit
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hth01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hth00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:hth00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
974720..976018
Genome map
AA seq 432 aa AA seqDB search
MKILLSEEEIPKSWFNITPYLPKPLEPPLDPQTKEPVSPDKLLAIFPEPIVEQEVSEKEW
IEVPEDVLRVYSLWRPTPLHRAKNLEEYLQTPAKIFYKNESVSPPGSHKPNTAVAQAYYN
KVSGVKRLTTETGAGQWGSSLAFATQFFNLECEVYMVRVSYNQKPFRRILMETWGAKVIP
SPSPYTRAGRKFYEENPEHPGSLGIAISEAIEKALTSSDTKYSLGSVLNHVLLHQTVIGL
EAKKQMEKAGYYPDYVVGAVGGGSNFAGLAFPFLKDKLTGEKPHLEVIAVEPEACPTLTK
GEYRYDYGDTVGLTPLIKMHTLGHEFVPPPIHAGGLRYHGDAPLLCLLYHEGYISASAYK
QRAVFEAAITFARTEGIVPAPESAHAIRKAIDIALECKERGEEKVILFNLSGHGYFDLSA
YDMYLKGELPDT
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaagatactgctatcggaggaggagataccaaaaagctggtttaatatcactccgtat
ttaccaaaacctctggagcctcctctggacccccaaacaaaagagccagtcagtccggac
aaactccttgccatatttccagagcctatagtggagcaggaggtttctgaaaaagagtgg
atagaagtgccagaggatgttctaagggtatactccctctggagaccaacaccccttcac
agggcaaagaaccttgaagagtaccttcagacacctgccaagatcttttacaaaaacgag
agcgtctcaccacccggaagccacaagccaaatactgcggtggctcaagcttactacaac
aaggtttcaggagttaaaaggctcaccacagagacgggtgcaggtcagtggggaagctcc
ttagcctttgccactcagttctttaaccttgaatgtgaagtttatatggtaagagtaagt
tataaccaaaagcctttcagaagaatacttatggaaacatggggagctaaagtaatccca
tcacccagcccttacactcgggcgggcaggaagttttacgaagagaacccagagcatcct
gggagtctcggtatagccataagtgaagctatagaaaaagctcttacctcttcggacacc
aagtactctcttggtagcgtcctaaaccatgtgcttttgcatcaaacggtaataggtctt
gaggcaaaaaaacagatggaaaaagcaggatactatcctgactatgtggtgggcgcggtc
ggtggtggtagcaactttgcagggcttgcctttcccttcctgaaggacaaactcacaggt
gaaaagccccaccttgaggtcatagcggtagagccagaagcctgccctaccttaacaaag
ggtgagtacagatacgactacggagatactgtaggcttgacgcctctgatcaagatgcac
accctcggacacgaatttgttcccccacctatacacgctggaggacttcggtatcacgga
gatgcccctcttttatgcctgctctaccatgaaggttatatatccgcatccgcctataag
cagagagctgtttttgaggctgctattacctttgcaagaacggaaggcatagttcccgcg
ccagaatcagcccacgccataagaaaagccatagacatagctttggagtgcaaagaaaga
ggagaagagaaggtgatactctttaacctatccgggcacggctactttgacctctccgcc
tatgatatgtacctgaagggtgaactgcctgacacttaa

DBGET integrated database retrieval system