KEGG   Hydrogenobacter thermophilus: HTH_1087Help
Entry
HTH_1087          CDS       T01167                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hth00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(993870..994430)
Genome map
AA seq 186 aa AA seqDB search
MAVDREKIKQAVRLFLEGIGEDPNREGLKETPDRVARMWEEFDSMREFDFKLFEEFGSYN
EMVLVKDINIYSICEHHLLPFFGKAHVAYIPDGIVCGLSKLVRTVRAFALRPQLQEKLTN
EIADFLMEQLKPKGVAVVLEMEHLCMSMRGVISPGHLTTTSALRGIFLSDIRTREEFLKL
IKRGRE
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggacagggaaaagataaagcaagctgtgaggcttttcttggaaggcataggt
gaagaccccaacagggaaggtctgaaagagacacccgacagggtagcccgtatgtgggaa
gagtttgacagcatgagagagtttgactttaagctctttgaagagtttggctcttacaac
gagatggttcttgtgaaagacataaacatatacagcatctgcgagcatcaccttctgccc
ttctttggcaaggctcatgttgcctacatacccgacgggatagtctgcggtctttccaag
ctggtaaggactgtaagagcctttgctctaagacctcagcttcaggaaaagctcaccaac
gagatagcggactttttgatggagcaactaaaaccaaaaggtgtggctgtggttttggag
atggaacacctgtgcatgtccatgaggggagttatatctccggggcaccttaccaccacc
tccgccttaaggggcattttcctgagcgacataagaacaagggaggagtttttaaagctc
ataaaaaggggaagggaatga

DBGET integrated database retrieval system