KEGG   Hydrogenobacter thermophilus: HTH_1096Help
Entry
HTH_1096          CDS       T01167                                 

Gene name
forB
Definition
(GenBank) 2-oxoglutarate:ferredoxin oxidoreductase beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hth  Hydrogenobacter thermophilus
Pathway
hth00010  Glycolysis / Gluconeogenesis
hth00020  Citrate cycle (TCA cycle)
hth00620  Pyruvate metabolism
hth00633  Nitrotoluene degradation
hth00640  Propanoate metabolism
hth00650  Butanoate metabolism
hth00680  Methane metabolism
hth00720  Carbon fixation pathways in prokaryotes
hth01100  Metabolic pathways
hth01120  Microbial metabolism in diverse environments
hth01130  Biosynthesis of antibiotics
hth01200  Carbon metabolism
Module
hth_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
hth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HTH_1096 (forB)
   00020 Citrate cycle (TCA cycle)
    HTH_1096 (forB)
   00620 Pyruvate metabolism
    HTH_1096 (forB)
   00640 Propanoate metabolism
    HTH_1096 (forB)
   00650 Butanoate metabolism
    HTH_1096 (forB)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HTH_1096 (forB)
   00680 Methane metabolism
    HTH_1096 (forB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HTH_1096 (forB)
Enzymes [BR:hth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HTH_1096 (forB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: BAI69554
UniProt: D3DIA2
Position
1001420..1002286
Genome map
AA seq 288 aa AA seqDB search
MGLEYVRISPGFERYMPKDYVDLVKYGQFGRQMDVQQLGQFKELVEEHPMCAGCFMAYFI
RVFYAALPNPEDTIVIGTAGCARLALSQAAVPFIYGNYGDTNAVASGLKRALTIRFPDKV
KDVVVMAGDGGLIDIGFGMTMHSWFRREKFTTIMVDNEVYGNTGGQESGMSPKGVQLKMA
PKGKQFDKINAVELAKVAGCVYVAKLAPTNPKRIAKTIRRAVLAARHFGPTFIHAYTSCN
IEYSIPTEKVLEDARKREKQDFGFYEWMTDEVKEYFEELERKPEEVRT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgggtttggaatatgtaaggatatcaccgggctttgagagatacatgcccaaagactac
gtggacttggtcaagtacgggcagtttggcaggcagatggatgtccagcaactgggtcag
ttcaaagagctggtggaagagcatcccatgtgcgcgggatgcttcatggcttacttcata
agggtgttctacgcagctcttcccaatccagaagatacaatagtgataggcacagcaggc
tgtgccagactggctctttctcaggcagcagtcccctttatatacggcaactacggagac
accaatgcggtggcctccggactcaagagagctctcaccatacgtttccccgacaaggtc
aaggatgtggtggtaatggctggcgacggtggtcttattgacataggctttggcatgacc
atgcactcctggttcaggcgcgagaagttcaccaccatcatggtagacaacgaggtttac
ggaaacacaggtggacaggaaagcggtatgtctcctaagggagtccagctcaagatggca
cctaaaggcaagcagtttgacaagataaacgctgtggagctggcaaaagtagctggatgc
gtttatgtggcaaagctcgctcctaccaatcccaagaggatagccaagaccataaggaga
gctgtgctggcggcaaggcactttggacctacctttatccacgcctacacctcctgcaac
atagagtactccatacccaccgaaaaggtgctggaagatgcaaggaagagagaaaagcaa
gactttggtttctacgagtggatgacggatgaggtaaaagagtactttgaagagttagaa
aggaagccagaggaggtaagaacatga

DBGET integrated database retrieval system