KEGG   Hydrogenobacter thermophilus: HTH_1097Help
Entry
HTH_1097          CDS       T01167                                 

Gene name
forG
Definition
2-oxoglutarate:ferredoxin oxidoreductase gamma subunit
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:hth01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hth00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hth00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hth00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hth00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hth00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:hth00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:hth00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:hth00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1002283..1002966
Genome map
AA seq 227 aa AA seqDB search
MKRYNIRIAGVGGQGVVTSAHILGNAMSAAGKYATLVPFFGSEKRMAPVEAYVRVSDQPI
YEVGEVVYPNVIMIYHPQVITHGKSYTMPFYSGLKENGLVIINTDADIIPEEDWKILNDL
NTRVHMFPATKLALEIAGTELATNMAMIGLFFGITKLVGFEHIEQAVRERFLGNTFVASG
GTTALDSAIEKKFKKKMELLEKNMQVIREAFKIAEERGWVEEEAYTS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctataatataagaatagcaggcgttggtgggcagggagttgtcacctctgcc
cacattcttggtaatgccatgtccgcggcaggaaagtacgccactcttgtcccctttttc
ggctctgaaaagagaatggcaccggttgaagcgtatgtgagagtctcagaccagcccata
tacgaggtgggtgaggtggtctaccccaacgtgataatgatataccacccccaagttata
actcacggcaagtcttacaccatgcccttttattcaggtcttaaagagaacggccttgtg
ataataaacacggacgcggacataatacccgaagaagactggaagatactcaatgaccta
aacacaagggttcatatgttccctgccaccaaactggcacttgagatagccggcaccgag
cttgccaccaacatggctatgataggtctcttctttggcatcacaaagcttgtgggcttt
gaacacatagagcaggctgtaagagagagattcctaggtaataccttcgtggcttctggg
ggtaccacagcccttgacagcgccatagagaagaagttcaaaaagaagatggagctactt
gaaaagaacatgcaggtcataagagaagcctttaagatagcggaggagcgtggctgggta
gaggaagaggcttacacttcttaa

DBGET integrated database retrieval system