KEGG   Hydrogenobacter thermophilus: HTH_1098Help
Entry
HTH_1098          CDS       T01167                                 

Gene name
forE
Definition
(GenBank) 2-oxoglutarate:ferredoxin oxidoreductase epsilon subunit, ferredoxin-like protein
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hth  Hydrogenobacter thermophilus
Pathway
hth00010  Glycolysis / Gluconeogenesis
hth00020  Citrate cycle (TCA cycle)
hth00620  Pyruvate metabolism
hth00633  Nitrotoluene degradation
hth00640  Propanoate metabolism
hth00650  Butanoate metabolism
hth00680  Methane metabolism
hth00720  Carbon fixation pathways in prokaryotes
hth01100  Metabolic pathways
hth01120  Microbial metabolism in diverse environments
hth01130  Biosynthesis of antibiotics
hth01200  Carbon metabolism
Module
hth_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
hth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HTH_1098 (forE)
   00020 Citrate cycle (TCA cycle)
    HTH_1098 (forE)
   00620 Pyruvate metabolism
    HTH_1098 (forE)
   00640 Propanoate metabolism
    HTH_1098 (forE)
   00650 Butanoate metabolism
    HTH_1098 (forE)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HTH_1098 (forE)
   00680 Methane metabolism
    HTH_1098 (forE)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HTH_1098 (forE)
Enzymes [BR:hth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HTH_1098 (forE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4_2 Fer4_10 Fer4 Fer4_6 Fer4_9 Fer4_4 Fer4_13 Fer4_15 Fer4_7 Fer4_16
Motif
Other DBs
NCBI-ProteinID: BAI69556
UniProt: D3DIA4
Position
1002983..1003207
Genome map
AA seq 74 aa AA seqDB search
MYYVADVNETDCAKYNCKQCVLFCPEPNTLMYHDSKHVAWVNYSRCKGCAICVYVCSDLL
KRNCIQMVMVTAGD
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgtactatgtggctgatgtaaacgaaacagactgcgccaaatataactgcaagcagtgc
gtgcttttctgtcctgagcctaacacgcttatgtaccacgactccaagcatgtggcttgg
gtcaattactccagatgtaaaggctgtgccatatgtgtgtatgtgtgttctgacctcctc
aaaagaaactgcatacagatggttatggtgactgcaggagactga

DBGET integrated database retrieval system