KEGG   Hydrogenobacter thermophilus: HTH_1104Help
Entry
HTH_1104          CDS       T01167                                 

Gene name
ccpR
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hth  Hydrogenobacter thermophilus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1010124..1011134
Genome map
AA seq 336 aa AA seqDB search
MRKSALLALLLVSGVYSKDGSDKDLLEKARQFFSPLPKSFPSEENPITPEKVKLGRLLFF
ERRLSVNDMISCATCHAVEYYYASPAPKQMGALKLQPRHAPTVLNSAGQFVQHWIGNRKD
VEDQALQSLTGPPALGNPSRESAEEKLKSIPAYVELFKKAFPKDKEPITAENIAKAIGAF
ERTLVTPSRFDEFLKGNTKALTEEEKKGLKTFIEVGCVSCHNGTLVGGTMYQKFGIYEPY
WKYTKSESIDEGRYAVTKKEEDKYVFKVPPLRNVAMTPPYFPDGSVTSLEEAVWIMGKVQ
LGKDLSKQQVRYIVAFLKSLTGRLPEEARKPPILPP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtcagcccttttggctttacttcttgtaagtggtgtatattcaaaagatggt
tcagataaagaccttctggagaaggcaaggcagttcttctccccactacccaagagcttc
ccatcggaggaaaaccccataacccctgagaaggtaaagcttggcaggcttctcttcttt
gagaggagactgtcggttaatgacatgataagctgcgccacctgccacgctgtagagtac
tattatgcatcccctgcacccaaacagatgggtgcgttaaagctccagcccagacacgca
ccaacagtgctcaactcagcgggacagtttgtccagcactggataggcaacaggaaggat
gtggaagaccaagccctccaatccctgaccggaccacccgccttgggaaatccctccagg
gaaagcgcggaagaaaagctaaaaagcatccctgcgtatgtggagcttttcaaaaaagca
tttccaaaggataaggagcctataaccgcagagaacatagcaaaagctataggagctttt
gaaagaacccttgtgactccttcaaggtttgacgagtttctcaaaggcaacaccaaagcg
ctaacggaagaggaaaagaagggtttgaaaacttttatagaagtagggtgtgtttcttgc
cacaacggcacccttgtggggggcaccatgtatcagaagtttggcatatacgaaccttac
tggaagtatacaaagagtgagagcatagacgaaggaaggtatgcagttactaaaaaggaa
gaagataagtatgtttttaaggtaccaccccttagaaatgtagccatgacaccaccgtat
tttcctgacgggtctgtcacaagccttgaagaagcggtgtggataatgggaaaggtccag
ctgggcaaagacctgagcaagcagcaggtaaggtacatagttgcttttctcaaaagttta
acgggcagactgcctgaagaagcgcgaaaaccgcctatcctcccaccgtaa

DBGET integrated database retrieval system