KEGG   Hydrogenobacter thermophilus: HTH_1109Help
Entry
HTH_1109          CDS       T01167                                 

Gene name
hemD2
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hth  Hydrogenobacter thermophilus
Pathway
hth00860  Porphyrin and chlorophyll metabolism
hth01100  Metabolic pathways
hth01110  Biosynthesis of secondary metabolites
hth01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HTH_1109 (hemD2)
Enzymes [BR:hth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HTH_1109 (hemD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: BAI69567
UniProt: D3DIB5
Position
complement(1014882..1015664)
Genome map
AA seq 260 aa AA seqDB search
MKLKGKRIALCITRRVEEAIESIVKLGGKPYVEDVVRIVALPDEVIKENIKNAVFEAPEI
FYFTTGEGTDVLLKKSREIGLYEPLLKGKVFARGYKVRARLINYGFKNFQSVESTRAFMN
MLKDIEILNTKILVQMYGEEMHELEEFLNNKGAKMLKLWLYRYETDTERLDAFIIKLLEG
FYHAVLFTSAYQVDYIFKRAKEKNLGKNLSSSLNNKVFTVAVGRKTAGKLFENGVLRVYY
PEKERLTYALKELEIAFKDG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgaagggtaaaaggatagctctatgtattacacgaagagtggaagaggctata
gaaagtatagtaaaactcggtggaaagccgtatgtagaagatgtggtcagaatagtggcg
ttgccagatgaagtaataaaggaaaatataaaaaacgcagtatttgaagcgccggagatt
ttttactttacaaccggtgaaggtacagacgtacttctaaaaaaatccagagaaatagga
ctctacgaacctctattaaaaggcaaagtttttgctaggggttataaggtgagggcaaga
ctgataaactatggttttaaaaattttcaaagcgtagaaagtactagggcttttatgaat
atgttaaaagacatagaaatactaaacactaagatacttgtgcagatgtacggggaggag
atgcatgaacttgaagagtttttaaacaataagggggcaaaaatgctaaagctctggctt
tacagatacgagacggatacagaaaggcttgatgcttttataataaagcttttggaaggc
ttttatcacgctgtgcttttcacctcagcctatcaagtggattatatctttaagagagct
aaagaaaagaatttaggtaaaaatctctcaagctctctaaacaataaggtattcaccgtt
gctgtaggaagaaagacggcgggtaagctttttgagaacggggttctgagggtttactat
ccagaaaaggagagactcacttacgctctgaaagagctggagatagcttttaaagatggg
taa

DBGET integrated database retrieval system