KEGG   Hydrogenobacter thermophilus: HTH_1156Help
Entry
HTH_1156          CDS       T01167                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hth00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1053642..1054160
Genome map
AA seq 172 aa AA seqDB search
MPVCYISFGSNWGDRVQNILKAISLVANLGNLEAVSTVYESLPWGIENQPPFLNGVLKLN
TNLGPIRLLKELKEIERYIGRKERYRWGPREIDLDILLYDGYILMLSFLRIPHPYMLERD
FVLFPLLELDENLIHPTLGQPIKLFAQSLKNNLKPYACITSYFLHTAPNSRV
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtttgctacatttcctttggaagcaattggggagatagagtgcagaacatacta
aaagctatctctttagtggcaaatttgggaaatctggaggctgtatccactgtatatgag
agtctgccatggggtatagaaaaccagccacctttcttaaatggcgttctaaagttaaat
accaaccttgggcctataagacttctgaaggagctaaaggagatagaaaggtacatagga
agaaaggaacgctacagatggggtcccagagagattgatttggatattttactttacgat
ggctatattttaatgctcagttttttaaggataccccatccgtatatgctggagagggac
tttgtacttttccctctccttgagctggacgaaaacctcattcaccccactttaggacag
cccataaagctctttgcccaaagtcttaaaaacaacctcaaaccctacgcctgtatcact
tcttactttttacatactgctcccaattctcgggtgtaa

DBGET integrated database retrieval system