KEGG   Hydrogenobacter thermophilus: HTH_1351Help
Entry
HTH_1351          CDS       T01167                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hth  Hydrogenobacter thermophilus
Brite
Enzymes [BR:hth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HTH_1351 (dsbC)
Secretion system [BR:hth02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HTH_1351 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1230047..1230790
Genome map
AA seq 247 aa AA seqDB search
MTKKLCILLSSTVILAVSSSCGAPSAKCPSKDAVKNSVKDLIPQDFTVESVSGVKEINGL
CEVVIKVGAQPLVFYTDSTGNYVVAGNIISLKDKKNLTRERQQEFMKVSTDQLKELEKHV
NFTYGQGKKFIYYITDPDCPFCKKSEPIIEDWAKKAGVQIKVILFPLPIHPQAFGKSVAL
VCDKKGWEELVKGYESKNQCDEGKKAITDNLQFLSQLGVNGTPTFVGMNGKMQSGVPTEE
DLNKLIN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaagttatgtattctgctctcgtccacagttattttagctgtttcatcctca
tgcggagcgccttccgccaaatgtcccagcaaagacgctgttaaaaattcagtgaaggac
ctcataccacaggactttactgtggaatcagtctctggagttaaagagatcaatggactg
tgcgaagttgttattaaagtaggtgcgcaacctctggtgttttataccgatagcacaggt
aattatgtagtggcaggcaacatcataagcctgaaggataagaaaaacttaaccagagaa
agacagcaggagtttatgaaagtatccacagaccagcttaaagagctggaaaagcacgta
aacttcacctacgggcagggcaagaagttcatttactacataacggacccagactgtccc
ttctgtaagaaaagcgaacccataatagaggattgggctaaaaaagcaggagtgcagata
aaagtaattctcttccctcttcctatacatccacaagcctttggcaaatctgtggctctt
gtgtgtgataagaagggatgggaagaactggtaaaggggtatgagtcaaaaaatcagtgc
gatgaaggtaaaaaggctatcaccgataaccttcagtttttgagtcagctaggcgtaaat
ggaacccctacctttgtgggtatgaacggcaaaatgcaatcgggagtacctacggaggag
gacctgaacaagctgataaactga

DBGET integrated database retrieval system