KEGG   Hydrogenobacter thermophilus: HTH_1367Help
Entry
HTH_1367          CDS       T01167                                 

Gene name
thrC2
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HTH_1367 (thrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HTH_1367 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HTH_1367 (thrC2)
Enzymes [BR:hth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HTH_1367 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1251024..1252082
Genome map
AA seq 352 aa AA seqDB search
MNYWRGIINKYREYLPISENTPVITLCEGNTPLIHAENLAREIGFKGEIYLKYEGLNPTG
SFKDRGMTLAISKAVEAGKKAVICASTGNTSASAAAYAAKAGLKAYVLLPKGAVALGKLS
QAVMYGAKVIAVQGNFDDALYMVRKIGELLPVEIVNSVNPFRIEGQKTAAFEVCDALGEA
PDYHFIPVGNAGNITAYWKGYLEYYRVGKIRKLPKMMGWQAEGAAPIVKGYVIKNPQTIA
SAIRIGNPYSWQQALAAANESKGRIDAVSDEEILNAYKLVASKEGIFCEPASAASIAGLI
KLVREGYLSGKEVVVCTLTGNGLKDPSTAMSVCQEPITLPPDIEKVLEVIEL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaactattggcgcggtataataaataaatacagggaatatttgcctatttcagaaaac
acacctgttataactctctgtgagggaaatactcctcttatacacgcggaaaatctcgcc
agggagataggctttaaaggggagatatatctcaaatatgagggactaaaccctacggga
tcctttaaagacagagggatgacccttgccatatcaaaagctgtagaagctggaaaaaag
gctgttatatgtgcttctacaggaaatacctccgcttctgctgcggcttatgctgcaaaa
gctgggctcaaagcttatgtgcttcttcccaaaggtgcagtggcactgggaaaactctct
caagcagttatgtacggtgcaaaggttatagccgtgcagggaaactttgacgatgctctt
tatatggtgagaaagataggtgagcttttgccggttgaaatagtcaactcggtaaacccc
ttccgtatagaggggcaaaagactgcagcctttgaggtatgtgatgccttgggcgaagcg
ccagattatcactttataccagtaggcaacgcaggaaacataaccgcttactggaaagga
tacttggagtattaccgcgtcgggaagataaggaaactccctaagatgatgggatggcag
gcggaaggtgctgctccaatagtgaaaggctatgttataaaaaatccgcaaactatagcc
agcgccataaggataggaaatccttacagctggcaacaggctcttgccgcagctaacgaa
tcaaagggaagaatagatgctgtaagtgatgaggagatcctaaatgcatacaagctggtg
gcttcaaaggaaggtatcttctgcgagcctgcctccgcagccagcatagcggggctcata
aagctggtaagggagggctaccttagtggtaaggaggtggtggtatgcacccttacggga
aatgggcttaaggaccccagcaccgctatgagcgtgtgccaagaacccatcaccttaccc
ccagacatagagaaggtgctggaggtgatagagctatga

DBGET integrated database retrieval system