KEGG   Hydrogenobacter thermophilus: HTH_1367Help
Entry
HTH_1367          CDS       T01167                                 

Gene name
thrC2
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hth  Hydrogenobacter thermophilus
Pathway
hth00260  Glycine, serine and threonine metabolism
hth00750  Vitamin B6 metabolism
hth01100  Metabolic pathways
hth01110  Biosynthesis of secondary metabolites
hth01120  Microbial metabolism in diverse environments
hth01230  Biosynthesis of amino acids
Module
hth_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HTH_1367 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HTH_1367 (thrC2)
Enzymes [BR:hth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HTH_1367 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAI69818
UniProt: D3DJ16
Position
1251024..1252082
Genome map
AA seq 352 aa AA seqDB search
MNYWRGIINKYREYLPISENTPVITLCEGNTPLIHAENLAREIGFKGEIYLKYEGLNPTG
SFKDRGMTLAISKAVEAGKKAVICASTGNTSASAAAYAAKAGLKAYVLLPKGAVALGKLS
QAVMYGAKVIAVQGNFDDALYMVRKIGELLPVEIVNSVNPFRIEGQKTAAFEVCDALGEA
PDYHFIPVGNAGNITAYWKGYLEYYRVGKIRKLPKMMGWQAEGAAPIVKGYVIKNPQTIA
SAIRIGNPYSWQQALAAANESKGRIDAVSDEEILNAYKLVASKEGIFCEPASAASIAGLI
KLVREGYLSGKEVVVCTLTGNGLKDPSTAMSVCQEPITLPPDIEKVLEVIEL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaactattggcgcggtataataaataaatacagggaatatttgcctatttcagaaaac
acacctgttataactctctgtgagggaaatactcctcttatacacgcggaaaatctcgcc
agggagataggctttaaaggggagatatatctcaaatatgagggactaaaccctacggga
tcctttaaagacagagggatgacccttgccatatcaaaagctgtagaagctggaaaaaag
gctgttatatgtgcttctacaggaaatacctccgcttctgctgcggcttatgctgcaaaa
gctgggctcaaagcttatgtgcttcttcccaaaggtgcagtggcactgggaaaactctct
caagcagttatgtacggtgcaaaggttatagccgtgcagggaaactttgacgatgctctt
tatatggtgagaaagataggtgagcttttgccggttgaaatagtcaactcggtaaacccc
ttccgtatagaggggcaaaagactgcagcctttgaggtatgtgatgccttgggcgaagcg
ccagattatcactttataccagtaggcaacgcaggaaacataaccgcttactggaaagga
tacttggagtattaccgcgtcgggaagataaggaaactccctaagatgatgggatggcag
gcggaaggtgctgctccaatagtgaaaggctatgttataaaaaatccgcaaactatagcc
agcgccataaggataggaaatccttacagctggcaacaggctcttgccgcagctaacgaa
tcaaagggaagaatagatgctgtaagtgatgaggagatcctaaatgcatacaagctggtg
gcttcaaaggaaggtatcttctgcgagcctgcctccgcagccagcatagcggggctcata
aagctggtaagggagggctaccttagtggtaaggaggtggtggtatgcacccttacggga
aatgggcttaaggaccccagcaccgctatgagcgtgtgccaagaacccatcaccttaccc
ccagacatagagaaggtgctggaggtgatagagctatga

DBGET integrated database retrieval system