KEGG   Hydrogenobacter thermophilus: HTH_1418Help
Entry
HTH_1418          CDS       T01167                                 

Gene name
thrC1
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HTH_1418 (thrC1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HTH_1418 (thrC1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HTH_1418 (thrC1)
Enzymes [BR:hth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HTH_1418 (thrC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1293806..1295038
Genome map
AA seq 410 aa AA seqDB search
MTKVKGLVCRECGKEYPVEPIHVCEFCFGPLEVVYDYQEIKKKLSKEKIENGPKSLWRYI
DLLPVEYPSVGLNAGFTPLKKAENLGRLLGLENLYIKDDSVNHPTLSFKDRVVSVALSKA
KEFGFDTVACASTGNLANSVAAHAAQAGFNCFVFIPANLESQKIFGSLVFKPTVVAVEGN
YDDVNRLCSEIANELNWAFVNINIRPFYAEGSKTLAFEVVEQLGWRAPDAVVAPAASGSL
ITKIWKGLKELYMVGLLDSLKTRVYGAQAEGCSPIAQAWKEGRDFVKPVKPNTIAKSIAI
GNPADGIYALQVTKESSGIWETATDEEIIEGIKLLAETEGIFTETAGGTTIAVLKKLAEK
GYFSPKEIVVAYITGNGYKTMEVLEGHLPESIRIKPTLADFKEKILVKTL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggtgaagggtcttgtttgcagagagtgcggaaaggagtatcccgttgagccc
atacatgtatgtgagttctgctttggaccccttgaggtagtttacgactatcaggagata
aagaagaagcttagtaaagagaagatagaaaatggacccaagagcctttggaggtatata
gaccttttgcccgttgagtatccaagcgttggtttaaacgctggctttacaccactcaaa
aaagccgagaatctgggaaggcttctgggacttgaaaacctctacatcaaagacgactct
gtaaaccatcccactttatccttcaaagatagagtggtttctgttgcgctatctaaagca
aaggagtttggctttgatacggtggcgtgcgcttctaccgggaaccttgccaattctgtg
gctgcgcatgcggcgcaggctggctttaactgttttgtctttattcctgcaaaccttgaa
tcgcagaagatctttggaagtcttgtctttaaacctacagtggtggctgtggaaggcaac
tacgatgatgtaaacaggctgtgttcggagatagccaacgagctaaactgggcttttgtc
aacataaacataagacccttctatgctgaaggttcaaaaacccttgcctttgaagtggta
gagcagttaggatggagagcgccagatgcggttgtggctcctgcagcatctgggtctttg
ataaccaaaatatggaaaggtctcaaggaactctatatggtaggtcttttggatagctta
aagacgagagtgtatggagcgcaggctgaaggttgctctccaatagctcaggcttggaag
gaaggcagggactttgtaaaacccgtaaaacccaatacaatagccaaatcaatagctatt
ggtaatcccgcggatggcatctacgcacttcaggtgacaaaagagagctctggcatatgg
gaaacagcaacggatgaggagatcatagaaggtataaagcttctggcagagacagaaggc
atattcacagagaccgccggtggaactaccattgcagtcctcaaaaaactcgcagagaaa
ggttacttctcaccaaaagagatagtggtggcatacatcacaggtaacggctacaagacc
atggaggtgcttgagggacaccttccagaaagcattagaataaagcccactcttgcagac
tttaaggagaagatacttgtgaagacattatga

DBGET integrated database retrieval system