KEGG   Hydrogenobacter thermophilus: HTH_1418Help
Entry
HTH_1418          CDS       T01167                                 

Gene name
thrC1
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hth01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hth00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:hth00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1293806..1295038
Genome map
AA seq 410 aa AA seqDB search
MTKVKGLVCRECGKEYPVEPIHVCEFCFGPLEVVYDYQEIKKKLSKEKIENGPKSLWRYI
DLLPVEYPSVGLNAGFTPLKKAENLGRLLGLENLYIKDDSVNHPTLSFKDRVVSVALSKA
KEFGFDTVACASTGNLANSVAAHAAQAGFNCFVFIPANLESQKIFGSLVFKPTVVAVEGN
YDDVNRLCSEIANELNWAFVNINIRPFYAEGSKTLAFEVVEQLGWRAPDAVVAPAASGSL
ITKIWKGLKELYMVGLLDSLKTRVYGAQAEGCSPIAQAWKEGRDFVKPVKPNTIAKSIAI
GNPADGIYALQVTKESSGIWETATDEEIIEGIKLLAETEGIFTETAGGTTIAVLKKLAEK
GYFSPKEIVVAYITGNGYKTMEVLEGHLPESIRIKPTLADFKEKILVKTL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggtgaagggtcttgtttgcagagagtgcggaaaggagtatcccgttgagccc
atacatgtatgtgagttctgctttggaccccttgaggtagtttacgactatcaggagata
aagaagaagcttagtaaagagaagatagaaaatggacccaagagcctttggaggtatata
gaccttttgcccgttgagtatccaagcgttggtttaaacgctggctttacaccactcaaa
aaagccgagaatctgggaaggcttctgggacttgaaaacctctacatcaaagacgactct
gtaaaccatcccactttatccttcaaagatagagtggtttctgttgcgctatctaaagca
aaggagtttggctttgatacggtggcgtgcgcttctaccgggaaccttgccaattctgtg
gctgcgcatgcggcgcaggctggctttaactgttttgtctttattcctgcaaaccttgaa
tcgcagaagatctttggaagtcttgtctttaaacctacagtggtggctgtggaaggcaac
tacgatgatgtaaacaggctgtgttcggagatagccaacgagctaaactgggcttttgtc
aacataaacataagacccttctatgctgaaggttcaaaaacccttgcctttgaagtggta
gagcagttaggatggagagcgccagatgcggttgtggctcctgcagcatctgggtctttg
ataaccaaaatatggaaaggtctcaaggaactctatatggtaggtcttttggatagctta
aagacgagagtgtatggagcgcaggctgaaggttgctctccaatagctcaggcttggaag
gaaggcagggactttgtaaaacccgtaaaacccaatacaatagccaaatcaatagctatt
ggtaatcccgcggatggcatctacgcacttcaggtgacaaaagagagctctggcatatgg
gaaacagcaacggatgaggagatcatagaaggtataaagcttctggcagagacagaaggc
atattcacagagaccgccggtggaactaccattgcagtcctcaaaaaactcgcagagaaa
ggttacttctcaccaaaagagatagtggtggcatacatcacaggtaacggctacaagacc
atggaggtgcttgagggacaccttccagaaagcattagaataaagcccactcttgcagac
tttaaggagaagatacttgtgaagacattatga

DBGET integrated database retrieval system