KEGG   Hydrogenobacter thermophilus: HTH_1495Help
Entry
HTH_1495          CDS       T01167                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hth  Hydrogenobacter thermophilus
Pathway
hth00010  Glycolysis / Gluconeogenesis
hth00020  Citrate cycle (TCA cycle)
hth00620  Pyruvate metabolism
hth01100  Metabolic pathways
hth01110  Biosynthesis of secondary metabolites
hth01120  Microbial metabolism in diverse environments
hth01130  Biosynthesis of antibiotics
hth01200  Carbon metabolism
Module
hth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HTH_1495
   00020 Citrate cycle (TCA cycle)
    HTH_1495
   00620 Pyruvate metabolism
    HTH_1495
Enzymes [BR:hth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HTH_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 QRPTase_N GCV_H HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: BAI69945
UniProt: D3DJE3
Position
1360841..1362085
Genome map
AA seq 414 aa AA seqDB search
MDYEVVMPQFSDTMERGKVVRWLKKEGDYVEKGEVLAEIEAEKAVMELQSFRSGILKKIT
VNEGEEVPVKTTIAIIELTEKRPVVEKPQEIKKPEEKPVEKVVEKKVEEIKPVERIELPP
GLASAYAKVLASQYGIDLQELQKEGRLPSPAHEKDIMELLSERYFTPKALETLRDYHLDP
KRLVEFFKGEKITEDMLLEYIEEFNIPKRVPISSVQKSLIANLTRSIKHPHFRIYETFDL
SLIPWDKDITLTHWLIKIVGDAMMYFDRLRATVEEDHYLITPNADVGVAISVDDELYAPV
IRKVNKKSLLEIAKEARELREKAQAGKLTLEDVKGGTLTISNMGMFGIASFDAVIPYGQV
CIVSVGALDENGRASINFTFDHRVVNGTHGALFVKHLKEKVLDRNYIKSLKRGL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggattatgaggtggtgatgcctcaattttcggatactatggagagggggaaagtggtg
cgctggctcaaaaaggagggcgattatgtagaaaagggtgaggttttggctgagatagag
gcagagaaggcagttatggagctccaatccttcagaagcggtatcctcaaaaagatcact
gtaaatgagggcgaagaagttcctgtaaaaaccaccatagccatcatagagttgacggaa
aaaagaccggtggtagaaaagccacaagaaataaaaaaacctgaggaaaaacctgtggag
aaggtggtagagaaaaaagtggaggaaattaaaccggtggagagaattgagctaccacct
ggtctcgcatccgcttatgctaaagtgttggcttcccagtatggcatagacctacaggaa
cttcaaaaggagggaaggctgccatcacccgctcatgagaaagatataatggagcttctg
agtgaaaggtactttacgccaaaggcactggaaactttaagggattaccatctggacccc
aaaagacttgtggagtttttcaaaggtgagaagataacagaggacatgcttttggaatac
attgaggagtttaacataccaaagagagtccccatatcaagcgtccaaaaaagccttata
gcaaacctcacgagaagtataaagcatccccactttaggatatacgaaacctttgacctg
tctctaataccttgggataaggacataactcttacccactggcttataaagatagtgggt
gatgccatgatgtactttgataggttgagggcaacagttgaagaagatcactatcttata
acacccaatgcggatgttggagttgccatatctgtagatgatgagctttatgctcccgtt
ataaggaaggtaaataagaagagccttttggagatagctaaggaggcaagggagctaagg
gaaaaggctcaggcaggtaagctaacccttgaagatgtaaaaggcgggacgctgactata
tccaacatgggtatgtttggaatagcttcctttgatgcagtgataccttacggtcaggta
tgtatagtgtccgttggtgcgctggacgagaacggcagggcaagtataaacttcactttt
gaccacagggtagtcaacggtacgcatggagcgctttttgtaaagcacttaaaagaaaag
gtgcttgacaggaattacataaagtctctaaagcgaggtttgtag

DBGET integrated database retrieval system