KEGG   Hydrogenobacter thermophilus: HTH_1552Help
Entry
HTH_1552          CDS       T01167                                 

Gene name
porB
Definition
pyruvate:ferredoxin oxidoreductase beta subunit
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HTH_1552 (porB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HTH_1552 (porB)
   00020 Citrate cycle (TCA cycle)
    HTH_1552 (porB)
   00620 Pyruvate metabolism
    HTH_1552 (porB)
   00640 Propanoate metabolism
    HTH_1552 (porB)
   00650 Butanoate metabolism
    HTH_1552 (porB)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HTH_1552 (porB)
   00680 Methane metabolism
    HTH_1552 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HTH_1552 (porB)
Enzymes [BR:hth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HTH_1552 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1416801..1417661)
Genome map
AA seq 286 aa AA seqDB search
MSYKIYEINEALREFIPKEIVDLEERATWGNPKRGVMDLPYTKELIEEHSLCAGCPESMA
LRYILASLPNPEDTIIVNSTGCTSLVFPHIALHTVHSLFGNQNAVASGIKRVLEWRFPDK
VKDVVVLAGDGAIVDIGLDCTLQSFFRQEKITTICFDNEVYANTGGQESGMTVKGHVFKM
APKGKQWDKVPMWQIAIDSGCHYVARLTVSSPKRVESVIKKAIYVAREVGPTYVHLYTPC
ILEIGLNSDDGLDEMRQRDKERFSFFEYMTPQAEEVINRVKEEGLL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtcatataaaatatacgagataaacgaagctcttagagagtttataccaaaggagata
gtggaccttgaagaaagagccacctggggtaatcccaagaggggcgtgatggaccttccc
tacactaaagagctcatagaagagcactccctgtgcgcgggatgtcccgagtctatggct
ctcaggtacatacttgcctccctgcccaatccagaagataccataatagtcaactccaca
ggatgcacatctctggttttcccacacatagcgctccacacggtccactccctgtttgga
aaccagaatgcggtagcttctggcataaagagagtgctggagtggagattcccagacaag
gtaaaggatgtggtggtgctggcaggtgatggtgcaatagttgatataggtcttgactgc
acactccagtctttcttcaggcaggagaagatcaccaccatatgctttgacaacgaggtt
tatgccaacacaggcgggcaggagagcggtatgacggtcaagggacatgtgtttaaaatg
gcacccaagggcaagcagtgggataaagtacccatgtggcagatagccatagactcagga
tgtcactatgtggcaaggctcaccgtgtcttcccccaagagagtagagagtgttataaag
aaggctatatatgtagcgcgggaagtaggacctacctatgtgcacctctacactccatgc
atactggagataggtctcaactccgacgacggtcttgacgagatgagacaaagggacaaa
gagagattttccttctttgagtacatgacgcctcaggctgaggaagtcataaacagagtg
aaggaggaaggactgctatga

DBGET integrated database retrieval system