KEGG   Hydrogenobacter thermophilus: HTH_1558Help
Entry
HTH_1558          CDS       T01167                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hth  Hydrogenobacter thermophilus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1421427..1421924)
Genome map
AA seq 165 aa AA seqDB search
MLMLVLVFLLLIPAFGGDLYSEFVREQVKEIPLSKAIVVGNGNNKLITFINPDCPHCRKE
WEELKPHLNRIKIYVFLFPFKTAPESYPKAFYIACSKNKLKALDEVLSGKLDGNPPKVKE
CPLVYEHINIAQKLGVRSTPYNIVLKEYKIIEGYNPELLKLLGVR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcttatgcttgtattggtatttttgcttttaatacctgcctttggaggagacttatac
tcggaatttgtaagggagcaggtgaaagaaatacccttaagtaaagccatagttgtggga
aatggaaataataagctcataacctttataaatccagactgtcctcattgtaggaaagag
tgggaggagctaaaaccccaccttaataggatcaagatttatgtattcctgtttcccttc
aaaacagctcccgaaagctatcccaaagccttttatatagcatgctcaaagaataagcta
aaagcccttgatgaggtgctatcgggcaagttggatggcaatccacctaaggtaaaggag
tgtccattagtatacgaacatataaacatagcgcaaaaactcggcgttaggtcaacacct
tataacatagtgctaaaagaatacaaaatcatagagggatacaatcctgagcttcttaaa
ctccttggtgtaagatga

DBGET integrated database retrieval system