KEGG   Hydrogenobacter thermophilus: HTH_1666Help
Entry
HTH_1666          CDS       T01167                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hth00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1518569..1519753)
Genome map
AA seq 394 aa AA seqDB search
MLIKSFKDRDAFYRFLKEKVGIFFKEADSRAFEGIFHVIYFEDKNTDPSLLFDCARSSCI
SIFYQEGRYAICGSEARIRDFCSCIVKKHKSLSFKILEGLINYRKKSFKLQYNYKVLPLG
IKTAVMGVLNVTPDSFSDGGLYMDVAQAVKRGVQMAQEGAEIIDIGGESTRPGSERISTD
EELKRVLPVLKELRKELPNIWISIDTYKSQVAKACLEEGADMINDISGGSFDEKMFDVIA
TYSCPYVMGHTKGRPEEWKHMTIIYEDVMQELVEWFEEGVQKLRQKGHKGDIILDPCIGF
GKLPEHNVEILKRFRELKVFGLPLLVGVSRKSFIGLIIEGLLRKKTEPRERLYGSLGALA
YAVIEGTNIVRTHDVKETKEFLALLDTIRTYGEF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcaaaagctttaaagacagagatgctttttacagatttctgaaggaaaaagtg
ggcatattctttaaagaggcggatagcagagcttttgaggggatttttcatgttatatac
tttgaagacaaaaatacagacccgagccttttgtttgattgtgccagaagctcttgcatt
tctatcttttatcaggaaggtagatatgccatatgcggaagtgaggcaaggataagggat
ttttgctcctgcattgtcaaaaaacacaagagtttatcctttaagatacttgaaggtctc
ataaattacagaaaaaagtccttcaaactccagtacaactacaaggtgctgccacttgga
ataaaaactgctgttatgggtgtgctcaatgtaactcccgactctttctctgatggtggt
ctctatatggatgttgcgcaggcggtcaaaagaggtgttcagatggcacaggagggagcg
gagatcatagacataggcggtgagtctacaagaccaggctccgagaggataagtaccgat
gaggagctaaagcgtgtccttccagtgcttaaagaactcagaaaagagcttcccaatata
tggatatccatagacacctataagtcgcaggtggcaaaggcgtgcttggaagaaggtgcg
gacatgataaatgacataagcggtggcagttttgatgaaaagatgtttgatgtgatagcc
acttatagctgtccttatgtgatgggacacacaaagggaaggccggaggagtggaagcac
atgaccataatatacgaggatgtgatgcaggagttagtggagtggtttgaagaaggcgtg
caaaagctcagacaaaaaggacacaaaggtgatataatactggatccgtgcatagggttt
ggtaagctccctgagcataatgtagagatactcaaaaggttcagagagcttaaagttttt
ggacttcctctgctggttggtgtatcaaggaagtcttttataggcttgattatagagggt
ttgctaagaaagaagacagaaccaagggagaggctatacggaagccttggtgcccttgct
tatgcggttatagaaggtaccaatattgtaaggacgcatgatgttaaggaaacaaaagag
tttcttgctttgctggatacgataaggacttatggtgaattttga

DBGET integrated database retrieval system