KEGG   Hydrogenobacter thermophilus: HTH_1666Help
Entry
HTH_1666          CDS       T01167                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HTH_1666 (folP)
Enzymes [BR:hth01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HTH_1666 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1518569..1519753)
Genome map
AA seq 394 aa AA seqDB search
MLIKSFKDRDAFYRFLKEKVGIFFKEADSRAFEGIFHVIYFEDKNTDPSLLFDCARSSCI
SIFYQEGRYAICGSEARIRDFCSCIVKKHKSLSFKILEGLINYRKKSFKLQYNYKVLPLG
IKTAVMGVLNVTPDSFSDGGLYMDVAQAVKRGVQMAQEGAEIIDIGGESTRPGSERISTD
EELKRVLPVLKELRKELPNIWISIDTYKSQVAKACLEEGADMINDISGGSFDEKMFDVIA
TYSCPYVMGHTKGRPEEWKHMTIIYEDVMQELVEWFEEGVQKLRQKGHKGDIILDPCIGF
GKLPEHNVEILKRFRELKVFGLPLLVGVSRKSFIGLIIEGLLRKKTEPRERLYGSLGALA
YAVIEGTNIVRTHDVKETKEFLALLDTIRTYGEF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcaaaagctttaaagacagagatgctttttacagatttctgaaggaaaaagtg
ggcatattctttaaagaggcggatagcagagcttttgaggggatttttcatgttatatac
tttgaagacaaaaatacagacccgagccttttgtttgattgtgccagaagctcttgcatt
tctatcttttatcaggaaggtagatatgccatatgcggaagtgaggcaaggataagggat
ttttgctcctgcattgtcaaaaaacacaagagtttatcctttaagatacttgaaggtctc
ataaattacagaaaaaagtccttcaaactccagtacaactacaaggtgctgccacttgga
ataaaaactgctgttatgggtgtgctcaatgtaactcccgactctttctctgatggtggt
ctctatatggatgttgcgcaggcggtcaaaagaggtgttcagatggcacaggagggagcg
gagatcatagacataggcggtgagtctacaagaccaggctccgagaggataagtaccgat
gaggagctaaagcgtgtccttccagtgcttaaagaactcagaaaagagcttcccaatata
tggatatccatagacacctataagtcgcaggtggcaaaggcgtgcttggaagaaggtgcg
gacatgataaatgacataagcggtggcagttttgatgaaaagatgtttgatgtgatagcc
acttatagctgtccttatgtgatgggacacacaaagggaaggccggaggagtggaagcac
atgaccataatatacgaggatgtgatgcaggagttagtggagtggtttgaagaaggcgtg
caaaagctcagacaaaaaggacacaaaggtgatataatactggatccgtgcatagggttt
ggtaagctccctgagcataatgtagagatactcaaaaggttcagagagcttaaagttttt
ggacttcctctgctggttggtgtatcaaggaagtcttttataggcttgattatagagggt
ttgctaagaaagaagacagaaccaagggagaggctatacggaagccttggtgcccttgct
tatgcggttatagaaggtaccaatattgtaaggacgcatgatgttaaggaaacaaaagag
tttcttgctttgctggatacgataaggacttatggtgaattttga

DBGET integrated database retrieval system