KEGG   Hydrogenobacter thermophilus: HTH_1703Help
Entry
HTH_1703          CDS       T01167                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HTH_1703 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HTH_1703 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HTH_1703 (trpA)
Enzymes [BR:hth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HTH_1703 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1549012..1549818)
Genome map
AA seq 268 aa AA seqDB search
MGRERLQRKLETLKDSGEKALVCYLMAGYPDYETSLQAFRVVLKSGADILEIGYPFSDPV
ADGPTIQMAHEEALRIGIKLKDVLRISSTLREEFPEVPFILMTYYNPVFKVGLERFCSLA
QESDIDGLIVPDLPAEESADLKKYTQKYGLSLILLASPTSSEKRLRLICEHTDDLTYLVS
ITGTTGEREELPLEGLKRNINTYRGICQKPVVIGFGISKGEQARAIGDLSDGVVVGSALV
KLAGERKLEELSKKVRELKSSLKFCPKV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgggaagagagagactacagagaaagttagaaactttaaaagatagcggagagaaagcc
cttgtgtgttatcttatggcgggttatcctgattacgaaacatcccttcaggcctttaga
gttgtgttaaagagtggtgcagatattttggagataggctatcccttctcagaccctgta
gcggatggaccaactatacagatggctcacgaggaagcattgagaatagggataaaactg
aaggatgttctgcgcataagctctaccctgagagaggagtttccagaagtaccctttata
ctcatgacctattacaatcctgtattcaaggtaggtcttgagaggttttgctctctggcg
caagagagtgatattgacggactgatagtacccgacttaccagccgaagagtctgcagat
ttaaaaaagtacactcaaaagtatggactctcccttattcttcttgcatcacccaccagc
tccgaaaagaggctaaggctcatatgtgagcatacggatgaccttacttacctggtatcc
atcactgggaccacgggcgagagagaggagctacccttagaagggctaaaaagaaatata
aacacatatagaggaatttgccaaaaacctgttgtaataggctttggcatctcaaagggg
gagcaggcaagagctataggcgacctttccgatggggttgtggtgggaagcgcattggta
aagttggctggtgagagaaaacttgaggagctctctaagaaagtacgagagttaaaatca
tcgttaaagttttgtccaaaagtgtag

DBGET integrated database retrieval system