KEGG   Hydrogenobacter thermophilus: HTH_1842Help
Entry
HTH_1842          CDS       T01167                                 

Gene name
hemD1
Definition
uroporphyrinogen-III synthetase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HTH_1842 (hemD1)
Enzymes [BR:hth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HTH_1842 (hemD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1676526..1677236
Genome map
AA seq 236 aa AA seqDB search
MIKVVLTRSEEDIQKDRELFEREGFVVIPLPLIKTEPVEFELLEDDFDFVVFPSAKAVNY
FLSRRRLKGNEKVIAVGEATKKAVERYNYSVYQVPENYYAEEIKLLLKGQKGKVLIPRSQ
EGREELIKELENLGFYVKALNVYTTKGVLYQKEEFLKKISEGDVVVFASPSAVRSFFANL
PKPEGAAILKEKKVVCIGKTTNQELFSLCGHSGLLPEKPSFESIVKLLKSLAQSLQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagttgtgctaaccagaagtgaggaggatatacaaaaagacagagagcttttt
gagagggaagggtttgtggtaatcccattacctcttataaaaactgagcctgttgagttc
gagcttctggaggatgactttgactttgttgtttttcccagtgctaaagcggtaaattac
tttctaagtagaagaaggttaaaaggtaacgaaaaggtcatagcggtgggtgaggctact
aaaaaagctgttgaaaggtataactacagtgtttatcaagttccagaaaattactacgct
gaagagataaaacttctgctgaaaggacagaaaggtaaggtgcttattccacgctcacag
gaaggtagagaggagcttataaaagagcttgagaatttaggcttctatgtaaaagcttta
aatgtttataccacaaaaggtgtgctttaccaaaaagaggagtttttgaagaagatatct
gagggtgatgttgttgtgtttgcaagcccttcagctgtcaggagcttttttgcaaatttg
ccaaagcctgagggtgcagctattttaaaagagaaaaaggtggtttgtattggcaaaact
accaatcaagagcttttttccctttgcggacattccgggcttttgcccgaaaaaccgagc
tttgaaagcattgtaaaactcttaaagtctctggcacagagtttgcaataa

DBGET integrated database retrieval system