KEGG   Hydrogenobacter thermophilus: HTH_1893Help
Entry
HTH_1893          CDS       T01167                                 

Gene name
sucC
Definition
succinyl-CoA synthetase beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hth  Hydrogenobacter thermophilus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Class
Metabolism; Overview; Carbon metabolism [PATH:hth01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hth00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hth00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:hth00660]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:hth00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1717461..1718612)
Genome map
AA seq 383 aa AA seqDB search
MKLHEHQAKEILKRYNLPVPEGKVAFSLQEALQVAEELSGYPLVVKAQVHCGGRGKAGGV
KLVKNQEELREAVESMLGKVLKTFQCPEGKPVSRVWIEKATNIEKEFYLSITLDRSVSKP
VFMASAEGGMEIEEVAKEKPEAIHTLHIDPALGLMPFQARKIAFKLGLPVNEFVRISLAL
YKMYTDMDASLVEINPLVLTKEGNLILLDAKVEIDDNAMLRHKDVEELEDLTQLDPLEIE
AKRYSLNYIKLDGNIGCMVNGAGLAMTTMDIIKLAGGDPANFLDVGGGANVEQIANAFRI
LMADKNVKAVFINIFGGILRCDRLAQGLIEAAKMVEIKVPVVVRMEGTNVEEGRRLLSES
GLNFVNAVDMWDGAKKATELALR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaacatcaggctaaggaaattttaaaaagatataacttacctgttcca
gaaggtaaggtagcttttagccttcaggaggctctgcaggttgctgaagagcttagcgga
tatcctttggtggtcaaagctcaggtacactgtggaggaagaggtaaagcaggcggtgta
aagctggtaaagaatcaggaggagctaagagaagcagttgaaagcatgctggggaaagtt
ttaaagaccttccagtgtcccgaaggtaagcctgtgagtagagtatggatagaaaaggct
accaacatagaaaaagagttttatctttccataactcttgacaggtctgtctcaaaacct
gtttttatggcaagcgcggaaggtggcatggagatagaagaagtggcaaaggaaaagcca
gaagctatacacacgctgcacatagacccagccctcggtcttatgccctttcaagcaagg
aagatagcctttaaacttggacttcccgtaaatgagtttgtaaggatatcccttgctctc
tacaagatgtatacggacatggatgccagcttggtggagataaacccactggtgcttact
aaagaaggaaacctaatcctcttggatgccaaggtggagatagacgataatgcaatgcta
aggcacaaggacgtggaggagcttgaggaccttacacagcttgacccccttgaaatagag
gcaaagcgttatagtctcaattacataaagctggatggtaacataggttgtatggtaaac
ggtgcaggtcttgccatgacaactatggacataataaagctggcgggcggagaccctgct
aacttccttgatgtgggtggaggtgctaatgtggaacagatagccaacgctttcaggatt
ctgatggctgacaaaaatgtaaaagcagtctttataaacatctttggggggatactcaga
tgcgataggttagctcaaggtcttatagaggcggcaaagatggtggagataaaggtgccg
gtggtggtcagaatggaggggactaatgtggaggagggaagaagattactgtcagagtcc
ggactaaactttgtcaatgctgtagatatgtgggacggtgccaaaaaggcaactgagttg
gcattaaggtaa

DBGET integrated database retrieval system