KEGG   Hydrogenobacter thermophilus: HTH_1893Help
Entry
HTH_1893          CDS       T01167                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hth  Hydrogenobacter thermophilus
Pathway
hth00020  Citrate cycle (TCA cycle)
hth00640  Propanoate metabolism
hth00660  C5-Branched dibasic acid metabolism
hth00720  Carbon fixation pathways in prokaryotes
hth01100  Metabolic pathways
hth01110  Biosynthesis of secondary metabolites
hth01120  Microbial metabolism in diverse environments
hth01130  Biosynthesis of antibiotics
hth01200  Carbon metabolism
Module
hth_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HTH_1893 (sucC)
   00640 Propanoate metabolism
    HTH_1893 (sucC)
   00660 C5-Branched dibasic acid metabolism
    HTH_1893 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HTH_1893 (sucC)
Enzymes [BR:hth01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HTH_1893 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A Succ_CoA_lig Dala_Dala_lig_C
Motif
Other DBs
NCBI-ProteinID: BAI70337
UniProt: D3DKI5
Position
complement(1717461..1718612)
Genome map
AA seq 383 aa AA seqDB search
MKLHEHQAKEILKRYNLPVPEGKVAFSLQEALQVAEELSGYPLVVKAQVHCGGRGKAGGV
KLVKNQEELREAVESMLGKVLKTFQCPEGKPVSRVWIEKATNIEKEFYLSITLDRSVSKP
VFMASAEGGMEIEEVAKEKPEAIHTLHIDPALGLMPFQARKIAFKLGLPVNEFVRISLAL
YKMYTDMDASLVEINPLVLTKEGNLILLDAKVEIDDNAMLRHKDVEELEDLTQLDPLEIE
AKRYSLNYIKLDGNIGCMVNGAGLAMTTMDIIKLAGGDPANFLDVGGGANVEQIANAFRI
LMADKNVKAVFINIFGGILRCDRLAQGLIEAAKMVEIKVPVVVRMEGTNVEEGRRLLSES
GLNFVNAVDMWDGAKKATELALR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaacatcaggctaaggaaattttaaaaagatataacttacctgttcca
gaaggtaaggtagcttttagccttcaggaggctctgcaggttgctgaagagcttagcgga
tatcctttggtggtcaaagctcaggtacactgtggaggaagaggtaaagcaggcggtgta
aagctggtaaagaatcaggaggagctaagagaagcagttgaaagcatgctggggaaagtt
ttaaagaccttccagtgtcccgaaggtaagcctgtgagtagagtatggatagaaaaggct
accaacatagaaaaagagttttatctttccataactcttgacaggtctgtctcaaaacct
gtttttatggcaagcgcggaaggtggcatggagatagaagaagtggcaaaggaaaagcca
gaagctatacacacgctgcacatagacccagccctcggtcttatgccctttcaagcaagg
aagatagcctttaaacttggacttcccgtaaatgagtttgtaaggatatcccttgctctc
tacaagatgtatacggacatggatgccagcttggtggagataaacccactggtgcttact
aaagaaggaaacctaatcctcttggatgccaaggtggagatagacgataatgcaatgcta
aggcacaaggacgtggaggagcttgaggaccttacacagcttgacccccttgaaatagag
gcaaagcgttatagtctcaattacataaagctggatggtaacataggttgtatggtaaac
ggtgcaggtcttgccatgacaactatggacataataaagctggcgggcggagaccctgct
aacttccttgatgtgggtggaggtgctaatgtggaacagatagccaacgctttcaggatt
ctgatggctgacaaaaatgtaaaagcagtctttataaacatctttggggggatactcaga
tgcgataggttagctcaaggtcttatagaggcggcaaagatggtggagataaaggtgccg
gtggtggtcagaatggaggggactaatgtggaggagggaagaagattactgtcagagtcc
ggactaaactttgtcaatgctgtagatatgtgggacggtgccaaaaaggcaactgagttg
gcattaaggtaa

DBGET integrated database retrieval system