KEGG   Halorhabdus tiamatea: HTIA_0590Help
Entry
HTIA_0590         CDS       T02781                                 

Definition
(GenBank) endoglucanase / peptidase M42 family protein
Organism
hti  Halorhabdus tiamatea
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(564662..565741)
Genome map
AA seq 359 aa AA seqDB search
MDDTRRDFLESLLDTASPSGFERSSQQVWIEYVSQFADEIRTDDYGNAVAVHEGDGECEI
AIAGHGDEIGFMVRDITEDGYLRLSRIGGSDRTVTRGQHVTVHTDDGPVSGVVGQTAIHL
RDRDEDAVADVAEQHVDIGVSDGEAARDRVEIGDSVTFTSGLHSLAGTRLSARGMDNSVG
IWTAAEALRRASEADAAATVYAVSTVQEELGLQGAKMVGFDLDPDAVVAVDVTHATDTPD
VPGKRSSDVELGGGPVVARGSVNHPRLVESLRSVADEEGLDVQLEATGIQTGTDADAFYT
QRGGIPSVNLGLPNRYMHTPVEVIDTEDLTDAAALLGAFAVTAESFAPFGVDFEAGDGA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggacgacacacgacgagactttctggagtcgttgctcgataccgcgagcccgtcgggg
ttcgaacgctcgagccagcaggtctggatcgagtatgtctcgcagttcgccgacgagatc
cgtaccgacgactacggcaacgccgtcgcggtccacgagggcgacggcgagtgcgagatc
gcgatcgccggccacggcgacgagatcggcttcatggtccgtgacattaccgaggacggc
tatctccgactgtcgcgtatcggcgggtccgatcggacggtcactcgcggccaacacgtt
accgttcacaccgacgacggccccgtctccggtgtcgtcggccagacggcgatccacctg
cgtgatcgcgacgaggacgcggttgcggacgtcgccgaacagcacgtcgacatcggtgtt
tcagacggagaagccgcacgcgaccgcgtcgagatcggcgattcggtgacgttcacctcg
gggctgcactcgctcgcggggacgcgcctgtcggcccgtgggatggacaacagcgtcggg
atctggacggccgccgaggcgctgcgtcgagccagcgaggccgacgcggcggcgacggtc
tacgctgtgagcaccgtccaggaagaactcggtctccagggtgcgaagatggtcgggttc
gacctcgatcccgacgccgtcgttgcggtcgacgtcacgcacgcgaccgacacacccgac
gtgccgggcaagcgatccagcgacgtcgaactcggcggcgggccggtcgtcgcgcgcggc
agtgtgaaccacccgcgactcgtcgagtcactccgctcggtcgccgacgaggagggtctc
gacgtccaactcgaagcgactggcatccagaccgggaccgacgccgacgcgttctacacc
cagcgtggcgggatcccgtcggtcaatctcgggctcccaaaccgttacatgcacaccccc
gtcgaagtgatcgacaccgaggatctgacggatgccgcggcgctactcggtgcgttcgcc
gtcaccgccgagtcatttgcgcccttcggcgtggacttcgaggcgggcgacggggcgtaa

DBGET integrated database retrieval system