KEGG   Halorhabdus tiamatea: HTIA_0916Help
Entry
HTIA_0916         CDS       T02781                                 

Definition
4-alpha-glucanotransferase, family GH77 (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hti  Halorhabdus tiamatea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hti00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HTIA_0916
Enzymes [BR:hti01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     HTIA_0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
883029..884516
Genome map
AA seq 495 aa AA seqDB search
MSFERQSGVFLHVSSLPGPDGIGTLGQPAREFVDFLVESDQSLWQTCPIGPTDAGQGNSP
YSAYSARAGNPLFIELDPLVEAGWLDEPDRPDFDDREVEFGRVRPFKQGALRNAFAGFEE
RADEDARAAFETFRTENAEWLDDYALFRALDAHFEADTWMDWPDDAKFRDPETLDRYREE
LAEDVRFRQFCQWRFERQWADLRAYAHERGIDLVGDMPIYVGANSVDVWANPEIFKLDDD
REPIYVAGVPPDDFSDTGQLWGMPVYDWETLAERDYDWWVQRFAGLLDRFDVFRIDHFKG
FESYYQVPAEEDTAMNGEWVSGPGRDFFAAVRDQLGELPIVVEDLGAITDATRELRDAFG
FPGMRVAGMADWCDAESTHHPASYDEPSVAYTSTHDTSTTVGWVKDLSKKQRECLYFAVD
HEGGPINWDVIETVWETPAVITFAQFQDFHGLGDEHRFNLPGTATGNWKWRMLDSELDSA
VADRLADVTRKADRT
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgagagacagagcggtgttttcctgcacgtgtcgtcgctgcccggtcctgac
gggatcggcacgctgggccagccggcccgggagttcgtcgactttctagtcgagagcgac
cagtccctctggcagacctgcccgatcggtccgaccgacgcgggccagggcaactcaccg
tattcggcgtattcggcacgcgccggcaatccgctgtttatcgaactcgacccgctcgtc
gaggcgggctggctcgacgagccggatcgccccgacttcgacgaccgcgaagtcgaattc
gggcgcgttcgcccgttcaagcagggcgcgctccggaacgccttcgcgggcttcgaggag
cgcgccgacgaggacgctcgggcggccttcgagaccttccgaaccgagaacgccgagtgg
ctcgacgattacgccctcttccgggcgttagacgcgcacttcgaggccgatacctggatg
gactggcccgacgacgcgaagttccgcgacccggagaccctggatcgctaccgcgaggaa
ctcgccgaggacgttcgcttccggcagttctgccagtggcgcttcgagcgccagtgggca
gacctgcgggcttacgcccacgagcgcgggatcgacctggtcggcgacatgccgatctac
gtcggggccaacagcgtcgacgtctgggccaaccctgagatattcaaactcgacgacgac
cgcgagccgatctacgtcgcgggcgtgccgcccgatgacttctccgacaccggacagctc
tgggggatgccggtctacgactgggagaccctggccgagcgggactacgactggtgggta
cagcgctttgcgggcctgctcgatcgcttcgacgtcttccggatcgaccacttcaaaggc
ttcgagagttactaccaggtccccgccgaggaggacaccgcgatgaacggcgagtgggtc
tcgggaccgggccgggacttcttcgcggccgtccgcgaccagctcggcgagttgccgatc
gtcgtcgaagacctgggtgccatcaccgacgcgacgcgggaactccgggacgccttcggg
ttccccgggatgcgcgtcgcggggatggccgactggtgtgacgccgagtccacccaccat
cccgcgagctacgacgagccctccgtcgcctacacctcgacccacgacacgagtacgacg
gtcgggtgggtcaaggacctctcgaagaaacaacgggagtgtctgtacttcgcggtcgat
cacgagggcgggccgatcaactgggacgtcatcgagactgtctgggagacgccggcggtc
atcacgttcgcgcagttccaggacttccacggcctcggcgacgagcaccgcttcaacctg
cccgggaccgccacgggcaactggaagtggcggatgctcgactcggaactcgactccgcg
gtcgcggaccgactcgccgacgtgacccggaaggccgaccggacttga

DBGET integrated database retrieval system