KEGG   Halorhabdus tiamatea: HTIA_0962Help
Entry
HTIA_0962         CDS       T02781                                 

Definition
endo-1,4-beta-xylanase, family GH10 (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
hti  Halorhabdus tiamatea
Brite
Enzymes [BR:hti01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     HTIA_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(935766..936752)
Genome map
AA seq 328 aa AA seqDB search
MASEKTLRQLADENDLTLGASITADAFRKYPDDPDVAQTLTREFNAVTTGNALKMGPLRP
DRNTYDFEDADAIVNLGVANDLLVRGHTLVWHNQTPGWFYPWDYTDDQLRTFLRDHIHTV
AGRYREKVDVWDVVNEAVADDGTMRETAWYDAMGEEYIDLAFQWANEVAPEADLFYNDYG
IDEINEKADGVYALLERLIDRGVPIDGVGLQMHAFRAQEYVDPEALGENIRRFKDLGLDV
HVTEMDVAYDRENVPENHLEHQAQYYRDILEACLDNGCDTLVTWGVHDTASWLRNYDQTI
TDDPLLFDEDFDPKPAYFAIKDLLESRV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgagaagacactccgccaactggccgacgagaacgacctcacgctcggtgca
agcatcacggcagacgcattcaggaagtaccccgacgatccggacgtcgcacagacgctc
acgcgggagttcaacgccgtcacgactggcaacgcactcaagatggggccgctgcgaccc
gaccggaatacctacgatttcgaggacgccgacgccatcgtgaacctcggggtcgcaaac
gacctgctggtccgcggtcacacgctcgtctggcacaaccagacgccggggtggttctac
ccctgggactacacagacgaccagctccgaacgttcctcagagaccacatccacaccgtt
gcgggccgctatcgcgagaaggtcgacgtctgggacgtcgtcaacgaggctgtcgccgac
gacggcaccatgcgcgagacggcgtggtacgacgcgatgggcgaggagtacatcgacctg
gccttccagtgggccaacgaagtcgcccccgaggctgacctcttctacaacgactacggc
atcgacgagatcaacgagaaggccgacggggtctacgcactcctcgaacgcctcatcgac
cgtggggtccccatcgacggcgtcggcctccagatgcacgccttccgcgcccaggagtac
gtcgaccccgaagccctcggcgagaacattcggcggttcaaagacctcggcctggacgtc
cacgtcaccgagatggacgtcgcctacgaccgcgagaacgtccccgagaaccacctcgaa
caccaggcccagtactaccgggacatcctggaggcgtgtctcgacaacggctgtgacacg
ctcgtcacctggggcgtccacgacacggcttcctggcttcgaaactacgaccagacgatc
accgacgacccgctgctcttcgacgaggacttcgatcccaagccggcctacttcgcgatc
aaggacctgctggagagtcgggtctga

DBGET integrated database retrieval system