KEGG   Halorhabdus tiamatea: HTIA_2290Help
Entry
HTIA_2290         CDS       T02781                                 

Definition
alpha-amylase, family GH13 (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
hti  Halorhabdus tiamatea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hti00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HTIA_2290
Enzymes [BR:hti01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HTIA_2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2299750..2300964)
Genome map
AA seq 404 aa AA seqDB search
MSVYGAPATGCKPRNEDAIDLGSGGVYQFYHTPWDAIREALPAVAAAGYDAIQVPPAQRS
KRTWADPEPRGYQPIDHLDFDSAFGTESEYQQMVETAHEQGLAVIADAVVNHMAEGVDFA
QFPHFGWGDFRHGGPIRDDTDEWELKHRDLEGLPDLRQESEHVREVLEAYVEKYARLGVD
GIRWDAVKHVPAWFFRDHANPWASERGLFTLGEVLHGSVDTCEEYLETGMTVMDYPLYFT
MHEEVFHRDGDFRALDGAGLVDRHPGRTVTFVSNHDSSPPEYEALAHAFILTYEGYPRVY
SGRFDPEDDTIARLLSIRRTLAVGPAHTRHVDRNTYVFEREGNLLVGLNRARERRSVTVE
TSWAATQLSERSDTGEDVTTDADGTVELSIPPTEWICYAPPSRS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtctacggtgcacccgcgaccgggtgcaaaccacgtaacgaggacgcgatcgac
ctcggatccggcggcgtctaccagttctatcacacgccctgggacgcgatccgcgaggca
ctccccgccgtcgccgcggcgggatacgacgcgatccaggtgccgcccgcccagcggagc
aagcgcacctgggcggacccggagccgcggggctaccagcccatcgaccacctggacttc
gacagcgcgttcggcaccgagagcgagtaccagcagatggtcgagaccgcccacgagcag
gggctggccgtcatcgccgacgcggtcgtcaaccacatggccgagggcgtcgatttcgcg
cagttcccgcacttcggctggggcgacttccggcacggcggtccgatcagggacgatacg
gacgagtgggaactaaagcaccgcgatctcgagggactcccggatctccgccaggaatcc
gaacacgtccgggaggtgctggaagcgtacgtcgagaagtacgcacggctgggcgtcgac
ggcatccgctgggacgcagtcaagcacgtcccggcatggttcttccgggaccatgcgaac
ccctgggcgagcgagcgagggctcttcacgctcggcgaagtcctccacggctcggtcgac
acctgcgaggaatacctcgaaacggggatgacggtcatggactacccgctctatttcacc
atgcacgaggaggtgtttcaccgcgatggggacttccgcgccctggacggggccggactc
gtcgatcgacaccccgggcggacggtgacgttcgtctccaatcacgacagctcgccaccc
gagtacgaggcactcgcacacgcgttcatcctcacgtacgaaggatatccgcgagtctac
agcggccgcttcgacccggaagacgacacgatagcgaggttgctttcgatccgccggacc
ctcgccgtggggcccgcacacacccgccacgtcgaccgcaatacgtacgtcttcgagcgc
gagggcaacctgctggtgggactcaaccgcgccagggagcgacggtcggtcacggtcgag
acgtcctgggcggcgacgcagctcagcgagcgatccgacaccggggaggacgtcacgact
gacgccgacggaaccgtcgaactctcgattccacccaccgaatggatctgttacgcgccg
ccgtcgaggtcctga

DBGET integrated database retrieval system