KEGG   Halorhabdus tiamatea: HTIA_2574Help
Entry
HTIA_2574         CDS       T02781                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hti  Halorhabdus tiamatea
Brite
Enzymes [BR:hti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     HTIA_2574
Transfer RNA biogenesis [BR:hti03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    HTIA_2574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2580683..2582365
Genome map
AA seq 560 aa AA seqDB search
MSTDAPDAVEDPFERACEELIDRILNGDLDRDGLEAAKRDVCSKHSSPTVPKNSDLLDRA
PDGRREELAAVVRRKPMRTASGVSPVAIMTSPERCPHGKCLYCPGGPDSEFESSQSYTGQ
EPAAARGVQNDYDPYGQVTLRLHQLRKIGHPVEKVELILMGGTMTARSHDYQEWFVKRAL
QAMNEYDPDCDPQPSETENFAQDPDEYDFRYLEDVIADNETGDVRNVATTFETKPDWCGP
EQVDRMLRLGGTKVEVGVQTTYESINREMHRGHGVDASIEANRRLRDAGFKVGFHMMPGQ
PGMTEEMVREDFRRLFERPEWRPDYLKIYPTLVVGGTVTYDMHRRGEFEPLTSEEAAELV
ADVKPTIPEYTRLQRVQRDIPAPLIEAGVQKSNLRQLARQRMEARGESCSCIRCREVGHS
DEEPEDVTLDVKKYEAAGGTEHFISFEDRDRDLLVGFSRLRFPGEVVRPELEDAAVVREL
HVYGSEIPIGEAGDEGEDWQHQGYGKQLIQRAEELAVDAGYGKLAILSGIGAREYYREQL
GYRQDGPYVSKMIWSCRKAV
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgatgcgcccgatgcggtcgaggatccgttcgaacgcgcctgcgaggagttg
atcgaccggattctgaacggcgacctcgaccgcgacggcctcgaagctgccaaacgcgac
gtctgctcgaagcactcctcgccgacggtgccgaagaactcggacctgctcgatcgggca
cccgacggccgacgcgaggagctggcggctgtcgtgcggcgcaagccgatgcgaacggcc
tcgggcgtctccccggtcgcgatcatgacctcgcccgagcgatgccctcacgggaagtgt
ctgtactgcccaggtgggccggactcggaattcgaaagctcacagagctacaccggccag
gagcccgccgcggctcgtggggtccagaacgactacgacccctacggacaggtgacgctc
cgactccaccagctccggaagatcggccaccccgtagagaaggtcgaactcatcctcatg
ggcggaacgatgaccgcacgcagccacgactaccaggagtggttcgtcaagcgcgccctc
caggcgatgaacgagtacgatcccgactgcgatccccagccctccgagaccgagaacttc
gcccaggaccccgacgaatacgacttccggtacctcgaagacgtcatcgccgacaacgag
accggcgacgtccgcaacgtcgcgaccaccttcgagaccaagcccgactggtgtggcccc
gaacaggtcgaccggatgcttcgcctcggcgggacgaaggtcgaggtcggcgtccagacc
acctacgagtcgatcaaccgcgagatgcaccgcggtcacggcgtcgacgcgagcatcgag
gccaaccgtcggctgcgcgatgcggggttcaaggtcggcttccacatgatgccgggtcag
ccaggtatgaccgaggagatggtccgggaggacttccggcgactcttcgagcgacccgag
tggcgaccggactatctgaagatctatcccacgctcgtcgtcggcgggaccgtcacctac
gacatgcaccgccgcggggagttcgagcccctcacgagcgaggaggccgccgaactcgtc
gccgacgtcaagccgacgattcccgagtacacgcgcctccagcgagtgcagcgtgatatt
ccggccccactcatcgaggccggcgtccagaagtcgaacctccggcaactcgcccgacag
cgcatggaagcacgcggcgagtcgtgttcgtgcatccggtgtcgtgaagtcggccacagc
gacgaggaacccgaggacgtgacgctcgacgtcaaaaagtacgaggccgcgggcggcaca
gagcacttcatcagtttcgaagatcgcgatcgcgatctgctggtcgggttttcacgcctc
cggttccctggcgaggtcgtccggccggaactcgaagacgcggccgtcgtccgggagttg
cacgtctacggcagcgagattccgatcggcgaggcgggcgacgagggagaggactggcaa
caccagggctacgggaagcaattgatccagcgcgcggaagaactcgccgtcgacgccggc
tacggcaaactcgcgatactcagcgggatcggtgcccgggaatactatcgggagcaactc
gggtaccgacaagacggcccgtacgtgagcaagatgatttggtcgtgtcgcaaagcggtc
tag

DBGET integrated database retrieval system