KEGG   Haloterrigena turkmenica: Htur_0011Help
Entry
Htur_0011         CDS       T01154                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00010  Glycolysis / Gluconeogenesis
htu00620  Pyruvate metabolism
htu00640  Propanoate metabolism
htu00680  Methane metabolism
htu00720  Carbon fixation pathways in prokaryotes
htu01100  Metabolic pathways
htu01110  Biosynthesis of secondary metabolites
htu01120  Microbial metabolism in diverse environments
htu01130  Biosynthesis of antibiotics
htu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Htur_0011
   00620 Pyruvate metabolism
    Htur_0011
   00640 Propanoate metabolism
    Htur_0011
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Htur_0011
   00680 Methane metabolism
    Htur_0011
Enzymes [BR:htu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Htur_0011
Lipid biosynthesis proteins [BR:htu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Htur_0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Robl_LC7
Motif
Other DBs
NCBI-ProteinID: ADB58912
UniProt: D2RST8
Position
complement(11336..13018)
Genome map
AA seq 560 aa AA seqDB search
MVSEHNMPDYEQVCDGFAWEDIEEAADWDAPGELNVAHEVCDRHAENKEKVALYQVSEDG
ELTTTTFWELAEATNRFANVLEDLGIERGDRVFSYMPRIPEHYVALIGTLKRGAVFGGIN
ERFGPDGISYRLSDCDATAIVTTADNRDTVADALENAPSVEHVIVVSDDGRGLRRGDVSY
RAAMETASREYEPADTGAEDDALLYYTSGTTGLAKGVLHEHRWVLGVAATQKYAVDLQEG
DCYWSTGDLGWLTGPINTLGAWFWGTALFTYEGEFDPETWADLLDTYPISVLFSVPTAYR
MLREHEDVLEDVSLDLRHALSIGEPLSAGVVEWGEETLGVTVHDTYGQTETGNMIINNYP
TMEVRPGSMGKPLPGIEAAVVDPETGEVLEPGETGEIAQRGDYPCFFAEYWEKPDKTADC
FVDGPDGEWYLSGDLAHLDEDGYFWFEGRADDVILSSGYRIGPFEVESSLGEHEAVAEAA
VVPKPHRERGNIVKAYIVPSEGATPSEELKEDIRTHVKEELSAHEYPREIEFRDELPKTV
TGKIRRTELQDEVEEEAEAT
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggtatcagaacacaatatgcccgactacgagcaggtctgcgacggcttcgcctgggag
gacatcgaggaagcggccgactgggacgcgcccggggaactgaacgtcgctcacgaggtc
tgtgaccgccacgccgagaacaaggaaaaagtcgcgctctatcaggtgagcgaggacggc
gagttgaccacgacgaccttctgggaactcgccgaggcgacgaaccgattcgcgaacgtc
ctcgaggacctcgggatcgagcggggcgaccgcgtcttctcgtacatgccgcggatcccc
gaacactacgtcgcgctgatcgggacgctcaagcgtggggccgtcttcggcgggatcaac
gagcggttcggccccgacggaatctcgtatcggttgtcggactgcgacgcgacggcgatc
gtgacgaccgccgataatcgggacaccgtcgcggacgcgctcgagaacgcgccctcggtc
gagcacgtcatcgtcgtcagcgacgacgggcggggactccgacggggcgacgtcagctac
cgcgcggcgatggagaccgcgagccgcgagtacgaaccggccgacaccggcgccgaggac
gacgcgctgctgtactacaccagcgggacgaccgggctcgcgaagggcgtcctgcacgaa
caccggtgggtgctgggcgtcgcggccacccagaagtacgccgtcgacctccaggagggc
gattgctattggtcgaccggcgatctgggctggctgaccgggccgatcaacacgctcggc
gcctggttctggggaactgccttgttcacctacgagggcgagttcgaccccgagacgtgg
gctgacctgctggatacctacccgatcagcgtcctgttctccgtgccgacggcctatcgg
atgctccgagaacacgaggacgtcctcgaggacgtctcgctggacctgcgccacgcgctc
tcgatcggcgaaccgctctcggcgggcgtcgtcgagtggggcgaggagacgctgggcgtc
accgtccacgacacctacggccagacggagactggcaacatgatcatcaacaactacccg
acgatggaggtccggccgggctcgatggggaaaccgttgcccggcatcgaggccgccgtc
gtagatccggagactggcgaggtgctcgagcccggcgaaacgggcgagatcgcccagcgc
ggggattacccctgcttcttcgcggagtactgggagaagcccgacaagaccgcggattgt
ttcgtcgacggccccgacggcgagtggtacctctcgggcgatctggctcatctggacgag
gacggctacttctggttcgagggccgggccgacgacgtcatcctctcgtcgggctaccgg
atcggccccttcgaggtcgagagctcgctgggcgaacacgaggccgtcgccgaggccgcc
gtcgttccgaaaccccaccgggagcggggcaacatcgtgaaagcctacatcgtccccagc
gagggcgcgaccccctccgaggagctgaaggaggacatccgaacccacgtcaaagaggag
ctctcggcccacgagtacccccgcgagatcgagttccgcgacgagctgccgaagacggtc
accgggaagatccgccggacggagctgcaggacgaagtcgaggaggaggcagaagcgacc
tga

DBGET integrated database retrieval system