KEGG   Haloterrigena turkmenica: Htur_0188Help
Entry
Htur_0188         CDS       T01154                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
htu  Haloterrigena turkmenica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Htur_0188
Enzymes [BR:htu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Htur_0188
Exosome [BR:htu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Htur_0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(208086..209111)
Genome map
AA seq 341 aa AA seqDB search
MDLTHRPRRLRRDRVRGLVSETSLEPTDLIAPVFVDATTDERVPIESMPGHERVPIDEAV
ARVEEVLETGVEAVMLFGIPESKDPEGTRAWAEDGVIQEALRRITSETDAYVITDVCLCE
YTDHGHCGPLEEELRNESGVAEDGPACEPTLTVDNDATLEALEKIVISHARAGADMVAPS
GMMDGMVGTIREALDSAGYEHVPIMSYAAKYESAFYGPFRDAADGAPSFGNRRHYQMDPA
NSREALREVRLDAEQGADVMMVKPALPYLDIVSAVRREFDHPVAAYNVSGEYAMLHAAAE
KGWLDLEEVALESLLSIKRAGADLILTYFAEDVARRLPAGQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggatctcacacatcgtccgcggcgactccgacgagatcgggtgcgcggcctcgtcagc
gagacgagcctcgagccgaccgacctgatcgcgccggtgttcgtcgacgcgacgaccgac
gagcgggtaccgatcgagtcgatgcccggtcacgagcgggtaccgatcgacgaggccgtc
gcccgcgtcgaggaagtcctcgagaccggcgtcgaggcggtcatgctgttcggcatcccc
gagtcgaaggaccccgagggaacccgcgcgtgggccgaggacggcgtcattcaggaagcg
cttcgccggatcacgagcgaaactgacgcgtacgtcatcaccgacgtctgtctctgcgag
tacaccgaccacggccactgcggtcccctcgaggaggagctccggaacgaaagcggtgtc
gccgaagacggcccggcctgcgaaccgacgctgaccgtcgataacgacgcgacgctcgag
gcgctcgagaaaatcgttatctcccacgcccgtgcgggcgcggacatggtcgccccgagc
ggtatgatggacggcatggtcggaacgatccgcgaagccctcgatagcgcggggtacgaa
cacgtcccgatcatgagctacgcggccaagtacgagagcgccttctacggcccgttccgg
gacgccgccgacggcgcgccctcctttggcaaccggcgccactatcagatggaccccgcg
aactctcgcgaggcgctgcgagaggttcgcctcgacgccgagcagggcgccgacgtcatg
atggtcaagcccgccctcccctatctcgacatcgtcagcgcggtgcgtcgggagttcgac
cacccggtcgccgcctacaacgtctccggcgagtacgcgatgctccacgccgccgccgag
aaaggatggctggatttagaggaggtagcgctcgagtcgctgctgtcgatcaaacgcgcg
ggcgcggatctgattctgacctacttcgcggaggacgtggcgcggcgactgcctgccggc
cagtag

DBGET integrated database retrieval system