KEGG   Haloterrigena turkmenica: Htur_0254Help
Entry
Htur_0254         CDS       T01154                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
htu  Haloterrigena turkmenica
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Htur_0254
Enzymes [BR:htu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Htur_0254
Peptidases [BR:htu01002]
 Cysteine Peptidases
  Family C44
   Htur_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
272537..274405
Genome map
AA seq 622 aa AA seqDB search
MCGIVGAYGWTHDETLSSMLDWIEHRGPDEEGSYLDRDAGLMMGARRLSIVDLEGGSQPK
WNEDETVGVVFNGEIYNHGELRERLSREGHQFESECDTEVLVHLWEEYGEEMVSHLEGMF
AFSIWDRETETVFLARDRFGIKPLYFGKTDRGYVWGSELPALLIGGVDRTIDPAAVYNHF
SLEYTPAPQTLLEDVWKVEPGQSVTITDDGVETRKYWDLLELETGTRTTSMAAAADRLRT
LLERSVEKRLMADVPVGAFLSGGLDSSAVTGIASQLKDDQLKTYSVSFTDDRLDESDEAR
LVADHFGTDHHEVDIDLSSMDLFGEMMQYLGEPTGHLQMLPMYALSERASQDVKVALAGE
GADELFAGYPWYQHVPEHKRKVDFMPEFTHDVAGAVAQVAPVGNKHLRYFSGLKNNEEML
LNHVCGFTTFRPEPDEFLRTGESAATSGLRANVGEVTAEVADPALEQHMSTYETGYTLPD
YHLYKADHMSMAQSLELRVPFLSKEMVEFAHSLPAELKVNDDDVKRVLKTAVSDLLPDQI
LEREKMGMRPPVEDWFEEEHDSIETWFTREKLRQTPYVDANRATALRDAHRRGEESVGRT
LWMILTYVAWYHSFIDEQNAVV
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcgttggtgcgtacgggtggacccacgacgagacgctctcgtcgatgctc
gactggatcgaacatcgcggccccgacgaggaggggtcgtacctcgaccgcgacgcggga
ctcatgatgggtgcgcgccgtctctcgatcgtcgacctcgagggcggctcccagccgaag
tggaacgaggacgagacggtcggcgtggtcttcaacggcgagatctacaaccacggcgag
ttgcgcgagcggctctcccgcgagggccatcaattcgagagcgagtgtgacaccgaagtc
ctggtccacctctgggaggagtacggcgaggagatggtctctcacctcgagggcatgttc
gcgttctccatctgggaccgcgagaccgagaccgtcttcctcgcccgcgaccggttcggc
attaagccgctgtacttcgggaagaccgaccggggctacgtctgggggagcgaactcccg
gcgctgctgatcggcggcgtcgaccggacgatcgatcccgcggccgtctacaaccacttc
tcgctcgagtacacgccggcgccccagaccctgctggaggacgtctggaaggttgaaccg
ggtcagtcggtgacgatcaccgacgacggggtcgagacgcggaagtactgggacctgctc
gagctcgagaccgggacgcggacgacgtcgatggcggcggcggccgaccgactgcggacc
ctgttggaacgctccgtcgagaagcgcctgatggcggacgtgccggtcggggcgttcctc
tcgggcgggctcgactcctccgccgtcaccggaatcgcttcgcaactgaaggacgatcag
ctcaagacctactccgtctcgtttaccgacgaccgcctcgacgagagcgacgaagcgcgg
ctcgtcgcggaccacttcggcaccgaccaccacgaggtcgacatcgacctctcgtcgatg
gacctgttcggcgagatgatgcagtacctcggcgagccgacgggccacctgcagatgctg
ccgatgtacgccctctccgagcgggccagccaggacgtcaaggttgcgctggccggcgag
ggcgccgacgaactgttcgcgggctacccgtggtaccagcacgtccccgaacacaagcgc
aaggtcgacttcatgccggagttcactcacgacgtcgccggggccgtcgcgcaggtggcg
ccggtcgggaacaaacacctccggtacttctccgggctgaagaacaacgaggagatgctg
ctcaaccacgtctgcggcttcacgaccttccgacccgaaccggacgagttcctccggaca
ggggagtcagccgcgacctccggcctgcgggcgaacgtcggcgaggtcaccgcggaggtc
gcggatccggccttagagcagcacatgtcgacctacgagacgggctacacgctgcccgac
taccacctctacaaggccgaccacatgagcatggcccagtcgctcgagcttcgcgtcccc
ttcctctcgaaagagatggtcgagttcgcccactcgctgccggccgaactcaaggtcaac
gacgacgacgtcaaacgggtgctcaagaccgccgtcagcgacctcctccccgatcagatc
ctcgagcgcgagaagatgggaatgcgcccgcccgtcgaggactggttcgaggaggaacac
gactcgatcgagacctggttcacgcgggagaaactccgacagacgccgtacgtcgacgcg
aaccgggccacggcgctccgggacgcccaccgccgcggcgaggagtcggtcggccggacg
ctctggatgatcctcacctacgtcgcctggtaccactccttcatcgacgagcagaacgca
gtcgtctga

DBGET integrated database retrieval system