KEGG   Haloterrigena turkmenica: Htur_0284Help
Entry
Htur_0284         CDS       T01154                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00010  Glycolysis / Gluconeogenesis
htu01100  Metabolic pathways
htu01110  Biosynthesis of secondary metabolites
htu01120  Microbial metabolism in diverse environments
htu01130  Biosynthesis of antibiotics
htu01200  Carbon metabolism
htu01230  Biosynthesis of amino acids
Module
htu_M00002  Glycolysis, core module involving three-carbon compounds
htu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Htur_0284
Enzymes [BR:htu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Htur_0284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 2-Hacid_dh_C GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ADB59185
UniProt: D2RUB6
Position
303196..304209
Genome map
AA seq 337 aa AA seqDB search
MIQVAINGYGTIGKRVADAVREQPDMEVRGVAKTRPNFEAETAVDKGFPLYAAVEERADQ
FADAGLEIAGPVEDLVDAADVVVDATPSGIGAENKSMYEAYDTPALYQGGEDADLVDTSF
NARSNFEDATGADHVRVVSCNTTGLSRVIAPLREAYGVEKVRATLVRRGGDPGQTSRGPI
NDILPNPVTIPSHHGPDVETIFDDLDIDTLGMKVPATLMHMHSLNVTLEEEVDASEVRDL
FAEESRLFLIPERMDIDGSGKLKEYALDAGRPRGDVWENCIWEESISTVGDDLYLFQGIH
QESDVVPENVDAIRAVLGEADAEESIETTNETMGIGL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatccaggtcgcgatcaacggctacggcacgatcggcaaacgcgtcgcggacgccgtc
cgcgagcagcccgatatggaggttcgcggcgtcgccaaaacgcgtcccaacttcgaggcc
gagacggccgtcgacaaggggttcccgctctacgcagccgtcgaagaacgggccgatcag
ttcgcggacgccggcctcgagatcgccggtccggtcgaagacctcgtcgacgcggccgac
gtcgtcgtcgacgcaacgccctcgggcatcggcgccgagaacaaatcgatgtacgaggcg
tacgacacgcccgcgctctatcagggcggcgaggacgccgacctcgtcgacaccagcttc
aacgcccgttcgaacttcgaggacgcgaccggggccgaccacgtccgcgtcgtctcctgt
aacacgacgggcctctcccgcgtgatcgcgcccctccgggaggcctacggcgtcgagaag
gtccgcgcgacgctcgtccggcggggcggcgaccccggccagacctcccgcggcccgatc
aacgacatcctgccgaacccggtgacgatcccctcccaccacggccccgacgtcgagaca
atcttcgacgatctggacatcgacacgctgggcatgaaggtccccgcgacgctgatgcac
atgcacagtctcaacgtcactctcgaggaggaggtcgacgcgagcgaggttcgcgacctg
ttcgccgaggagtcccggctcttcctgatccccgagcggatggacatcgacggcagcggc
aagctcaaggagtacgcgctggacgcgggccgcccgcgcggcgacgtctgggaaaactgc
atctgggaggagtcgatctccaccgtcggcgacgacctctacctcttccaggggattcac
caggagagcgacgtcgtccccgagaacgtcgacgcgatccgagcggtgctcggcgaagcc
gacgccgaggagagcatcgagacgaccaacgagacgatgggcatcgggctgtag

DBGET integrated database retrieval system