KEGG   Haloterrigena turkmenica: Htur_0346Help
Entry
Htur_0346         CDS       T01154                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
htu  Haloterrigena turkmenica
Brite
Enzymes [BR:htu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Htur_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
365977..366642
Genome map
AA seq 221 aa AA seqDB search
MFRNFGSDSESDPDDYEAARERMVRTIASRVDDDRVLEAMESVPRHAFVPPDRRDRAYED
RPLPIGDGQTISAPHMVAVMADLLGLDSGDEVLEIGTGCGYHAAVTAELVGDEAVATVEY
SAELADRAREQLAELGYDGVDVRTGDGREGWPEHAPYDAAYFTCATAELPDPVADQVRPG
GTLLAPIGSGFQTLVEATKRGDGRLERTEHGGVRFVEIRGQ
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtaacttcggttccgattccgagtccgatcccgacgactacgaggccgcacgc
gagcgcatggttcggaccatcgcgtctcgagtcgacgacgatcgcgttctcgaggccatg
gagtctgtcccccgccacgctttcgtcccgccggaccgacgggatcgggcctacgaggac
cggcccctcccgatcggggacggacagacgatcagcgcgccacacatggttgccgtgatg
gccgatctgctcggcttagattccggcgacgaggtcctcgagatcggcaccggttgtggc
taccacgccgcggtcacggccgagctcgtcggcgacgaggcggtcgcgaccgtcgagtac
agcgccgaactcgccgaccgggcccgcgagcaactcgcggaactcgggtacgacggggtc
gacgttcggaccggcgacggtcgcgagggctggcccgagcacgcgccctacgacgccgcg
tacttcacgtgcgcgactgcggagctccccgatcccgtcgccgatcaggtgcgccccggc
ggcacgctcctcgcgccgatcgggtccggattccagacgctcgtcgaggcgacgaaacgg
ggggacggacggctcgagcgcaccgagcacggcggggtccggttcgtggaaatacgcggc
cagtaa

DBGET integrated database retrieval system