KEGG   Haloterrigena turkmenica: Htur_0347Help
Entry
Htur_0347         CDS       T01154                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
htu  Haloterrigena turkmenica
Brite
Enzymes [BR:htu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Htur_0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
366718..367467
Genome map
AA seq 249 aa AA seqDB search
MDPAVLREDMVDGLESAAKDVLHDEVVAVAMRDVPRHEFLEDDRSAYADREHEVLGTRVL
APSTAARLLQALALEDDHEVLIVGAGVGYTAGVVAEVVGETNVHAVDISRPLVVEARQNL
ARAGYEGVLVDRRDGADGLPEYAPFDRVLLEAAAVEPPRALLEQLTDDGRLVFPRGTQRQ
RLEAVSADGRRSQFDPVSFAPLLVEGEQSGAVERNRTAREDREYAVRRAESRRGWEQDWI
EWEESIGSQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggaccctgcggtactgcgcgaggatatggtcgacggcctcgagtccgcggccaaggac
gtcctccacgacgaggtcgtcgccgtcgcgatgcgggacgttccccgccacgaattcctc
gaggacgatcgatcggcctacgctgaccgagaacacgaggtgttgggaacgcgcgtcctc
gctccgagcacggccgcccgattactgcaagcgctggccctcgaggacgaccacgaggtg
ctgatcgtcggcgccggggtcggctacacggccggggtcgtggccgaagtcgtcggcgag
accaacgtccacgcggtcgatatctcccgaccgctggtcgtcgaagcccgccagaacctc
gctcgagcaggctacgagggcgtactggtcgaccgccgcgacggcgccgacggcctcccg
gaatacgcgccgttcgatcgcgtgctcctcgaagccgccgccgtcgagcccccacgagcc
ctgctcgagcaactgaccgacgacggccgactggtgtttccgcggggaacccagcgacag
cgactcgaggccgtctcggccgacggcaggcgctcgcagttcgatcctgtctcgtttgcg
ccgctgttggtcgagggcgaacagtcgggcgccgtcgagcggaaccggacggctcgcgaa
gaccgggagtatgccgtgcgccgcgcggaatcccgacgcggttgggaacaggactggatc
gagtgggaggagtcgatcggctcgcagtga

DBGET integrated database retrieval system