KEGG   Haloterrigena turkmenica: Htur_0468Help
Entry
Htur_0468         CDS       T01154                                 

Definition
ATPase P
Orthology
K01533  
Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
htu  Haloterrigena turkmenica
Brite
Enzymes [BR:htu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.4  Cu2+-exporting ATPase
     Htur_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
487561..490023
Genome map
AA seq 820 aa AA seqDB search
MCPDSRNPDSSERPHTPAPSSPAEGSDGCDLCDLPLPSVPITDPDVDGTYCCRGCLEVAR
TLERRDDGPDEAAVRSRLDGADAAGGRDLDDLDGEDAFLAVDGMHCSTCEAFLESVAERE
AGVLGATASYATDTIRIVYDPDRLAADDLPEIVSGYGYTAADRSGADGDAGSDDGLARLL
LGGFFGMMVMVWYVLFLYPTYFDLEPVVAFGGYELAFLSANIWAFTSFILFYTGYPILRG
AYVSLRAGRPNMDLLVATAALGSYGYSAVAIVLGESHLYFDVTVAVVLVVTAGTHYERAV
KRRATGLLSELTERQVDEARLESGETVPLEAVEPGDRLLVRPGERVPLDGEVLEGSAAVD
ESLVTGESLPVRKTPGDELRGGTVVTDAPIVLGVGDEAESTLDRLVSLLWSIQSARPGVQ
RLADKLATVFVPLVVALAVSTAAVLLATGSSPSTALLIGLTVVIVSCPCALGLATPLAIA
AGVQAAAKRGIVVAAETIFEDAPDVDVVVLDKTGTLTTGKMAVEGVHVVDGTDSDELLRR
AGAVESLSEHPIAAAVVEAAPVAAADGIGDPATGTDGSAVDSFERADRGVSGVVDGDRVV
VGHPDFCRERGLSVPDSLESPIEDARAAGRVPVGVGWDGRTRGVVAVGDSEREELDAALE
SLSSGREIVVLTGDEGPAAERFRAVDGVDEVFAGVPPEAKAETVDRLRRRGTVAMVGDGS
NDAPALAAADVGIAMGGGTQLATDAADAVIVGDDLEAVGETLEITASTHRRIRQNLGWAF
CYNAVAIPLAVAGLLNPLFAAVAMAASSLLVVLNSSRSLR
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgtgcccagactcacggaacccagactcgtcggaacgcccgcacacgcccgcaccgtcg
tcgccggccgaggggagcgacggctgcgacctctgtgacctgccgctcccgtcggtaccg
atcaccgatcccgacgtcgacggcacctactgctgtcgcggctgtctcgaggtcgcgcga
accctcgagcgacgcgatgacgggcccgacgaggcggcggtccgatcgcggctggacggg
gcggacgcggcgggcggccgcgacctcgacgatctcgacggcgaggacgccttcctcgcg
gtcgacggcatgcactgctcgacctgcgaggcgttccttgagtcggtcgccgagcgcgag
gcgggcgtgctgggcgcgacggcgagctacgcgacggacacgatccggatcgtctacgat
ccggaccggctcgcggccgacgacctccccgagatcgtctcgggctacggctacaccgcg
gccgaccgatcgggcgccgacggcgacgcgggctccgacgacgggctcgctcggctgctg
ctcggcggcttcttcggcatgatggtcatggtgtggtacgtcctctttctctacccgacc
tacttcgacctcgagccggtcgtcgccttcggcggctacgagctcgcgtttctgtccgcg
aacatctgggcgttcacgtcgttcatcctcttctacaccgggtacccgatcctccggggc
gcgtacgtcagcctccgggcgggacgaccaaacatggacctgctcgtcgcgacggccgcg
ctcggctcgtacggctacagcgcggtcgcgatcgtcctcggggagagccacctctacttc
gacgtcaccgtcgccgtcgtcctcgtcgtcaccgcgggcacccactacgagcgggcggtc
aagcgccgcgcgacggggctgctctcggaactgaccgaacgccaggtcgacgaggcccgc
ctcgagagcggcgagacggtcccgctcgaggccgtcgagcccggcgatcggctgctcgtc
cggcccggcgagcgggtccccctcgacggcgaggtcctcgaggggtccgcggccgtcgac
gagtcgctggtcaccggcgagtccctgcccgttcggaagactcccggcgacgaactccgc
ggcggcaccgtcgtcaccgacgcgccgatcgtcctcggggtcggcgacgaggccgagagc
accctcgaccggctcgtctcgctgctctggtcgatccagagcgctcggcccggcgtccag
cggctcgcggacaagctcgcgacggtgttcgtcccgctggtcgtcgccctcgccgtctct
acggccgccgtcctactcgcgaccggctcgagcccgtcgaccgccctcctgatcggactg
acggtcgtcatcgtctcctgtccctgcgcgctcgggctggcgacgccgctggcgatcgcc
gcgggcgtccaggccgccgcgaagcgcgggatcgtcgtcgccgcggagacgatcttcgag
gacgccccggacgtcgacgtcgtcgtgctggacaagacggggacgctgacgaccggcaaa
atggccgtcgagggcgtccacgtcgtcgacggaaccgactcggacgagttgcttcggcga
gccggcgcggtcgaatcgctgtcggagcacccgatcgccgccgccgtcgtcgaggcggcg
cccgtcgccgcggccgacggcatcggcgaccccgcgaccggtaccgacggttccgccgtc
gactcgttcgagcgagccgaccgcggcgtcagcggcgtcgtcgacggcgaccgcgtcgtc
gtcggccatcccgacttctgccgcgagcgcgggctgtcggttccagattccctcgagtca
ccgatcgaagacgcccgcgcggccggtcgcgtcccggtcggcgtcggctgggacggccgg
actcgcggcgtcgtcgcggtcggcgattcggaacgcgaggagctcgacgcggccctcgag
tcgctctcgtcgggtcgcgagatcgtcgtcctcaccggcgacgaggggccggccgccgag
cggttccgcgcggtcgacggcgtcgacgaggtcttcgcgggcgtcccaccggaggcgaaa
gccgagaccgtcgaccgcctccgcaggcgggggacggtcgcgatggtcggcgacgggagc
aacgacgcgcccgcgctggccgccgccgacgtcggcatcgcgatgggcggcgggacccaa
ctcgcgaccgacgcggccgacgcggtgatcgtcggcgacgacctcgaggccgtcggcgag
acgctcgagatcaccgcgagcacgcaccggcgcatccgtcaaaatctcggctgggcgttc
tgctacaacgcggtggcgatcccgctggcggtcgccggcctgctgaaccccctcttcgcc
gccgtcgcgatggccgcgagcagcctcctggtcgtgctcaactcctcgcgctcgctccga
tga

DBGET integrated database retrieval system