KEGG   Haloterrigena turkmenica: Htur_0854Help
Entry
Htur_0854         CDS       T01154                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00260  Glycine, serine and threonine metabolism
htu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
htu01100  Metabolic pathways
htu01110  Biosynthesis of secondary metabolites
htu01130  Biosynthesis of antibiotics
htu01230  Biosynthesis of amino acids
Module
htu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Htur_0854
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Htur_0854
Enzymes [BR:htu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Htur_0854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PucR His_biosynth PcrB ThiG
Motif
Other DBs
NCBI-ProteinID: ADB59749
UniProt: D2RXR5
Position
complement(872245..873117)
Genome map
AA seq 290 aa AA seqDB search
MTDDVPSATGEYDSDIEAAIRENHPALITYLTAGDPSLEDTKAYVEALDRGGADLIELGL
PFSEPIAEGPTIQAAINRALEAGTTPEGFFELVDELETEAPLLVMTYYNMILQYGDEPDV
RPFVERAAEAGLSGIIVPDLPAEEADPLREACDDHGLDLVFIVAPTTEGERLETIMSQVS
GFAYVQARLGTTGARADVSTATHESLARLAEYDVPKAVGFGVSEGDHAAEIIEADADGVI
VGSALIDIVASSDDPAADLEAKAEELKRGAIRGAETVTVDTEDTPEPEQP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacgacgtaccgtcggccaccggcgagtacgacagcgacatcgaggcagccatc
cgcgagaaccaccccgccctgatcacctacctcacggcgggcgacccctccctcgaggac
accaaagcgtacgtcgaggccctcgaccgcggcggcgcggacctgatcgaactcggcctc
ccgttctcggagccgatcgcggaggggccgacgatccaggccgcgatcaaccgcgcgctc
gaggccgggacgacccccgagggcttcttcgagctggtcgacgaactcgagaccgaggcg
ccgctgctggtgatgacctactacaatatgatcctgcaatacggagacgaaccggacgtt
cgtcccttcgtcgagcgcgcggccgaggccggcctctcggggatcatcgtccccgacctc
cccgccgaggaggccgacccgctgcgcgaggcctgcgacgaccacggcctcgatctggtc
ttcatcgtcgcgccgacgaccgaaggcgagcgcctcgagacgattatgtcgcaggtctcg
ggcttcgcctacgtccaggcccgcctcgggacgacgggcgcccgcgcggacgtctcgacg
gcgacccacgagagcttagcgcgcctcgcggagtacgacgtgcccaaggcggtcggcttc
ggcgtcagcgagggcgaccacgcggccgagatcatcgaagccgacgccgacggcgtcatc
gtcggcagcgcgctgatcgacatcgtggccagcagcgacgatccggcggccgaccttgag
gcgaaagccgaggaactcaaacgcggcgcgatccgcggcgcggagaccgtcacggtcgat
acggaagatacaccggaaccagaacagccataa

DBGET integrated database retrieval system