KEGG   Haloterrigena turkmenica: Htur_0895Help
Entry
Htur_0895         CDS       T01154                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
htu  Haloterrigena turkmenica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(914514..915581)
Genome map
AA seq 355 aa AA seqDB search
MESVPFDFEFLTELTETSGVPGYEDRVRDLVVDEFEENVDRIRTDAMGNVVGTLEGESDY
SVAVAAHMDEIGFMVRHLKGSEDGFGFVELDALGGWDARVLKAQRVTIHTDDGDLPGVIG
SPPPHTLSDEDREKTPEVEDVVVDVGLPYEDLEERVSPGDLVTMDQTTERVGETVTGKAL
DDRICLFAMLEAARRITEPDVTIHFCATVQEEVGLRGARALGVDVDPDLALALDVTVAND
IPGFEAGDRVTELGDGAAIKLKDGSVITNPKVHKRLQSVADEAEIDYQREILPAGGTDTA
GFQLSNGAKPVGAISIPTRYLHTPTEAAHVDDVAAMIDLLEAFLSSEDGKEDYTL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgtcccgttcgatttcgaatttctcacggaactgaccgagacgagtggcgtc
cccggctacgaggaccgcgtccgtgacctcgtcgtcgacgagttcgaggagaacgtcgac
cggatccgaaccgacgcgatggggaacgtcgtggggacgctcgagggcgagtccgactat
tcggtcgccgtcgcggcccacatggacgagatcggcttcatggtccgccacctcaagggc
agcgaggacggcttcggcttcgtcgaactcgacgcgctgggcggctgggacgcgcgcgtc
ctcaaggcccagcgggtgacgatccacaccgacgacggcgacctgccgggggtcatcggt
tcgccgccgccacacaccttgagcgacgaggaccgcgagaagactcccgaggtcgaggac
gtcgtcgtggacgtcggtctcccctacgaggacctcgaggagcgggtctcgcccggtgac
ctcgtgacgatggatcagacgaccgagcgcgtcggtgagacggtcaccggcaaggcgctc
gacgaccggatctgtctgttcgcgatgctcgaggcggctcgccggatcaccgagcccgac
gtgacgatccacttctgtgcgaccgtccaggaggaggtcggcctgcggggcgcccgcgcg
ctgggcgtcgacgtcgatcccgatctggcgctcgcgctcgacgtcaccgtcgccaacgac
atccccggcttcgaggccggcgatcgcgtcaccgaactcggcgacggcgcggcgatcaaa
ctcaaggacgggagcgtcatcacgaacccgaaggtccacaagcggctccagtcggtcgcc
gacgaggcggaaatcgactaccagcgcgagatcctccccgccgggggcaccgacacggcc
ggcttccagctttccaacggcgccaaacccgtcggcgcgatctcgattccgacgcgatac
ctccacacgccgaccgaggccgcccacgtcgacgacgtcgcggcgatgatcgatctcctc
gaggcgttcctctcgagcgaggacggcaaggaggactacactctctga

DBGET integrated database retrieval system