KEGG   Haloterrigena turkmenica: Htur_0934Help
Entry
Htur_0934         CDS       T01154                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
htu  Haloterrigena turkmenica
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Htur_0934
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Htur_0934
   00650 Butanoate metabolism
    Htur_0934
  Energy metabolism
   00190 Oxidative phosphorylation
    Htur_0934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
959872..960237
Genome map
AA seq 121 aa AA seqDB search
MAERYSSFAPGGTAWLLQRVTAAFLVVVLAFHFFLLHFVNHAAEIEFAGTQARMENVGYF
LTMVSFLVAGTFHGVNGVYNALINQGLDGTQKKVVLAVLVIASLALIAQGIYVATTMAGW
T
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgatactcctcgttcgcgccgggcggcaccgcgtggttgctccagcgagtc
acggcggccttcttagtcgtcgtactcgccttccacttcttcctcctacacttcgtcaac
cacgccgcggagatcgagttcgccggcacccaggcccgcatggagaacgtcggctatttc
ctgacgatggtgtcgttcttggtcgcaggtaccttccacggcgtcaacggcgtctacaac
gctctgatcaaccaggggctggacggaacgcagaagaaagtcgtcctcgcagtgcttgtt
atcgcgagccttgcactcatcgcgcagggaatctacgttgcgactaccatggcggggtgg
acctaa

DBGET integrated database retrieval system