KEGG   Haloterrigena turkmenica: Htur_0976Help
Entry
Htur_0976         CDS       T01154                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Htur_0976
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Htur_0976
   00620 Pyruvate metabolism
    Htur_0976
   00640 Propanoate metabolism
    Htur_0976
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Htur_0976
   00680 Methane metabolism
    Htur_0976
Enzymes [BR:htu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Htur_0976
Lipid biosynthesis proteins [BR:htu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Htur_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1001696..1003675)
Genome map
AA seq 659 aa AA seqDB search
MSQEDSNLEARLEEQETFEPSDSFVEQANVSDPGVYEEFEENWPECWERAADLLSWDEEY
DTVLEDGNAPFYEWFTGGELNASYNCLDRHVEEGRGDSVAIEWEGELGETRTYTYSELLD
EVEDFAATLRDLGVEENDIVTLYMPMVPELPIAMLACARIGAPHSVVFAGFSADALATRM
NSADSEYLVTCDGYYRRGDALDHLSKTNEGLEGVEHEVSDVVVVDRLGDDLDHDLADNQH
DYDELVADHEGSTVEPVSRDAEDMLFLMYTSGTTGQPKGVKHTTGGYLAYTAWTSHAVLD
IEADDTYWCSADIGWITGHSYIVYGPLALGTTSVMYEGTPDYPDKDRLWEIVEKNEVDIF
YTAPTAIRAFMKWGAEYTENHDLSSLRLLGTVGEPINPRAWKWYYKHIGNEECPIVDTWW
QTETGGMMITTLPAINEMKPGSAGPPLPGIDARVVDANGEEVDAGQAGYVTVNNPWPGML
RTLYQNDERFIEEYWQEYSDPDADEWVYFPEDGAKIDEDDYITILGRVDDVINVSGHRLG
TMEIESAVVGVEGIAEAAVVGGDHDVKGEAVYVYAIPEDGYEDRHDELEEKAMEAVLDSI
GPIARPEEIVFTPELPKTRSGKIMRRLLENIASGDELGDTSTLRNPEIVDEIADQVADD
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggaggattccaacctcgaggcgagactcgaggaacaggagacgttcgaaccc
tccgactcgttcgtcgagcaggcgaacgtctcggatccgggggtatacgaggagttcgaa
gagaactggccggagtgttgggaacgagcggccgacctgctctcgtgggacgaggagtac
gataccgtcctcgaggacgggaacgcaccgttttacgagtggttcaccggcggcgagttg
aacgcgtcgtataactgcctcgaccggcacgtcgaggagggccgcggcgacagcgtggcc
atcgagtgggaaggggaactcggcgagacgcggacctacacctacagcgaactgctggac
gaggtcgaggatttcgccgcgacgcttcgcgacctcggcgtcgaggagaacgacatcgtc
acgctgtacatgccgatggtcccggagctgccgatcgcgatgctggcctgcgctcgcatc
ggtgcaccgcacagcgtcgtcttcgccggcttctcggcggacgcgctggcgacgcggatg
aattcggccgacagcgagtacctcgtcacctgcgacggctactaccgccgcggggacgcg
ctcgatcacctctcgaagaccaacgagggcctcgagggcgtcgagcacgaggtgtccgac
gtcgtggtggtcgaccgactgggcgacgacctcgaccacgacctcgcggacaaccagcac
gactacgacgaactcgtcgccgaccacgaggggtcgacggtcgagcccgtttcgcgggac
gccgaggacatgctgttcctgatgtacacctcggggacgacgggccagcccaagggcgtc
aagcacaccaccggcggctacctcgcctacacggcctggacctcccacgccgtactggac
atcgaggccgacgacacctactggtgctcggcggacatcggctggatcaccggccactcc
tacatcgtctacggcccgctcgcgctgggcacgacctcggtcatgtacgaggggacgccg
gactatccggacaaggatcggctgtgggagatcgtcgagaagaacgaggtcgacatcttc
tacaccgcgccgacggccatccgcgcgttcatgaagtggggcgcggagtacaccgagaac
cacgacctgtcgtcgctgcgcctgctcggcaccgtcggggagccgattaacccgcgggcc
tggaagtggtactacaagcacatcggcaacgaggagtgtccgatcgtcgacacctggtgg
cagaccgagaccggcgggatgatgatcacgacgctgcccgcgatcaacgagatgaaaccc
ggctccgccgggccgccgctgccgggcatcgacgcccgcgtcgtcgacgcgaacggcgag
gaggtcgacgccggacaggccggctacgtcacggtgaacaacccgtggccaggcatgctc
cggacgctctaccagaacgacgagcgcttcatcgaggagtactggcaggagtactccgac
cccgacgccgacgagtgggtctacttccccgaagacggcgcgaagatcgacgaggacgac
tacatcaccatcctcggccgggtcgacgacgtgatcaacgtctccggccaccggctcggg
accatggagatcgagtcggccgtcgtcggcgtcgaggggatcgccgaagccgccgtcgtc
ggcggcgaccacgacgtcaagggcgaggccgtttacgtctacgccatcccggaggacggt
tacgaggaccgccacgacgaactcgaggagaaggccatggaggccgtgctcgactcgatc
gggccgatcgctcggcccgaggaaatcgtcttcacgcccgaactcccgaagacgcgctcg
ggcaagatcatgcgccgcctgctcgagaacatcgccagcggcgacgagttgggtgacacc
tcgacgctccggaaccccgaaatcgtcgacgagatcgccgaccaggtcgcggacgactga

DBGET integrated database retrieval system