KEGG   Haloterrigena turkmenica: Htur_1006Help
Entry
Htur_1006         CDS       T01154                                 

Definition
von Willebrand factor A
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
htu  Haloterrigena turkmenica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:htu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1037323..1039572
Genome map
AA seq 749 aa AA seqDB search
MVAESGDKKLSSLPFPAIVGQNELKRVLLAVATNDGLDGALIVGEKGTAKSTAVRGLVDL
LPEQRAVADCPYGCAPDAPNLQCDDCRERDPEAMPVETRPVPLVTLPLGATRDRVVGTLS
VEDALAGAADFDPGLLARAHRGILYVDEVNLLDDHLVDVILDAAASGVNTVERDGVSVSH
PAEFTLVGTMNPEEGDLRPQLRDRFALQATVEGCREIDQRVEIIDRALETDASGAGGSDG
PEPWTEYADETATLREELAAARDRLAEVTLPDDFKAEIADLCLEAGVDGHRGDVATARTA
MTIAALEGRTTVIESDVHEAASYTLPHRLRSTPFEDEPDVEDLLEDRFDEESTDESESED
DADGDESADGGDGDESETESDDGETGTEPGGERSDGDGDDGESDGNDGDADSETDDSSPE
RRPDEGDDPTGGEPSPAEAGNGSDETGDSSESDSNDGDGSDGDGESGDEGDENAQPLVPG
QQRADVAAVGEATSPDLETPDAESADAATASGSRASTAPSTDNRGARVRTEPASGDGPID
AAASVRSAATRGDSRVQKRDLRQSVRTGDTSATIVFAVDASASMRPAMRTAKGVVLDLLR
DSYEHRDRVAFVAFAGEDADVLLPPTDSVSLAARHLKELPSGDRTPLPAGLETSRRVLER
AETDASVVVCVTDGRANVADGSPTEATRRAARGLAAEDATVIVVDAGDDSRAGLSELVAA
ETGGEVVALEALSSETVRAAADHAASGGQ
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggttgcagagtccggagacaaaaagctgtcgtcactcccctttccggccatcgtcggc
cagaacgagttgaagcgggtgctgctcgccgtcgccaccaacgacggcctcgacggcgcc
ctgatcgtcggcgagaaggggaccgcgaagtcgaccgcggtgcgagggctcgtggatctc
ctccccgaacagcgggccgtggccgactgtccgtacggctgtgcgcccgacgcgccgaat
ctgcagtgcgacgactgccgcgaacgcgatccggaagcgatgcccgtcgaaacccggcca
gttccgctcgtgacgcttccgctgggtgcgactcgagaccgcgtcgtcgggaccctctcg
gtcgaggacgcgctggccggcgcggccgacttcgatcccggactgctcgcccgcgctcat
cggggcatcctctacgtcgacgaggtcaacctgctggacgaccacctcgtggacgtcatt
ctcgacgcggccgccagcggggtcaatacggtcgagcgtgacggagtcagcgtctctcac
cccgccgagttcaccctcgtcgggacgatgaaccccgaggagggcgacctccgcccccaa
ctgcgggaccgcttcgccctgcaagccaccgtcgagggctgtcgtgagatcgaccagcgc
gtcgagatcatcgatcgggcgctcgagacggacgccagtggcgctggcggatctgacggg
ccggaaccctggaccgagtacgccgacgagacggcgaccctgcgcgaggaactcgcggcg
gcccgcgaccgccttgccgaagtcacgctcccggacgatttcaaggcggagatcgccgac
ctctgtctcgaggccggcgtcgacggccaccgcggcgacgtggcgaccgctcggacggcg
atgaccattgccgcgctcgagggccgaacgacggtcatcgagtccgacgttcacgaggcc
gccagctacacgcttccccaccgcctccggagcacgccgttcgaagacgaacccgacgtc
gaggacctgctcgaggaccgcttcgacgaggagtcgacggacgagagcgaaagcgaggac
gatgcggacggcgacgagtccgcggacggaggcgacggagacgagtccgagaccgagagc
gacgacggtgagacgggaaccgaacccggcggcgagcgcagcgacggtgacggtgacgac
ggcgaatccgacgggaacgacggcgacgccgattccgagaccgacgactcgagtcccgag
cgtcgacccgacgagggcgacgacccgaccggcggtgagccgtcgcccgccgaagccggc
aacgggagcgacgagaccggcgactcgagcgaatccgattcgaacgacggtgacgggagc
gacggagacggcgaaagcggcgacgagggagacgagaacgcccagccgctcgtccccggc
cagcagcgcgccgacgtcgccgcggtgggcgaggccacgtcgccggacctcgagacgccc
gacgccgagagcgcggacgcggcgacggcgagcggttcgcgagcgagcacggccccaagc
acggacaaccgcggtgctcgagttcggaccgaacccgcgtcgggggacggccctatcgac
gcggcggcgtcggttcgctccgccgcgacccgcggcgactcccgggtacagaagcgggac
ttgcgtcagtcggtccgcaccggcgacacgtcggcgacgatcgtcttcgcggtcgacgcc
agcgcctcgatgcgccccgcgatgcgcaccgcgaagggcgtcgtccttgatctgctgcgg
gacagctacgagcaccgcgatcgggtcgcgttcgtcgccttcgccggcgaagacgccgac
gtcctcctgccgccgaccgacagcgtctcgctggccgcgcgccacctcaaggaactcccc
tcgggcgatcggacgccccttcccgcgggcctcgagacctcgcggcgagtcctcgagcgc
gcggagacggacgcctcggtcgtcgtctgcgtgaccgacggccgggcgaacgtcgccgac
ggcagtccgaccgaggcgacgcgacgggcggcccgagggctcgcggccgaggacgcgacc
gtgatcgtcgtcgacgccggcgacgactctcgggccggcctctcggagctggtcgccgcc
gaaacggggggcgaagtggtcgccctcgaggcgctgtcgtccgagacggtccgagcggcg
gcggaccacgccgcatcggggggacagtaa

DBGET integrated database retrieval system